Upload
keilah
View
27
Download
1
Embed Size (px)
DESCRIPTION
Séminaire Genopole d’Evry du 17 Juin 2005. MicroScope : Bases de données pour la (ré)-annotation de génomes bactériens. Dr Claudine Médigue (“Atelier de Génomique Comparative”). Claude Scarpelli (Equipe informatique du Genoscope”). Aurélie Lajus Stéphane Cruveiller Zoé Rouy - PowerPoint PPT Presentation
Citation preview
Séminaire Genopole d’Evry du 17 Juin 2005
MicroScope :Bases de données pour la (ré)-
annotation de génomes bactériens
Dr Claudine Médigue (“Atelier de Génomique Comparative”)
Claude Scarpelli (Equipe informatique du Genoscope”)
Aurélie Lajus Stéphane Cruveiller Zoé RouyDavid Vallenet
Laurent Sainte-Marthe Sylvain Bonneval
Bases/b
anq
ues g
éno
miq
ues
Sequençage
Prédictionde gènes
Annotationfonctionnelle
Prediction de régions codantes, promoteurs, terminateurs, RNAs
Recherche de similarités, familles de protéines, domaines, …Suggestion de fonctions, classification
Ré-annotation Validation/mise à jour des annotationsDonnées d’expression, phenotypes de mutant, etc.
Annotationmanuelle
Intégration dans d’autresplateformes d’analyse
Validation des annotations automatiques,Recherche complémentaires (littérature, bases spécialisées),Analyse contextuelle, fusions de gène, interactions de protéines , phylogénie, etc…
Annotation des génomes bactériens
Labo ‘humide’+ Bioinformatique
EffortManuel
Bioinformatique
Bioinformatique
Labo ‘humide’ + Bioinformatique
PROCEDURES AUTOMATIQUES
INDISPENSABLES
INTERFACESGRAPHIQUES
INDISPENSABLES
Bioinformatique
Annotation des génomes bactériens
Bases/b
anq
ues g
éno
miq
ues
Sequençage
Prédictionde gènes
Annotationfonctionnelle
Ré-annotation
Annotationmanuelle
Intégration dans d’autresplateformes d’analyse
Annotation des génomes bactériens : contexte internationale
TIGR : pipeline annotation, bases de données, interface Web (service + formation)
Aux Etats Unis :
Univ. Wisconsin : base de données de séquences et d’annotations + données d’expression (E. coli)
Pipeline automatique à l’ORNL (http://genome.ornl.gov/microbial)
puis intégration au site IMG du DOE (http://img.jgi.doe.gov/v1.1/main.cgi)
Au MIPs : automatic annotation of bacterial proteomes (plateforme d’annotation experte PedantPro)
En Allemagne
GenDB plateforme d’annotation automatique + expert (« open source »)
Univ. Bielefeld.
Au Danemark
http://www.cbs.dtu.dk/services/GenomeAtlas/ Atlas des données de génomes publiés
En Angleterre :
Sanger Center Outil d’annotation graphique de génomes
Projets de ré-annotation de génomes bactériens au TIGR Base de données CMR (Comprehensive Microbial Resource)
Gènes en plus
«Primary annotation» : annotations originales+ « TIGR annotation » : annotations automatiques
Portion du génome de S. typhimurium (Genome Browser de CMR) :
Projets de ré-annotation de génomes bactériens au NCBI Projet RefSeq (Reference Sequence)
Gènes en plus/en moins
Reviewed RefSeq : annotations automatiques + ‘curation’ manuelle par des experts du NCBI.
Provisional RefSeq :
Provisional RefSeq : annotations originales
annotations automatiques uniquement
gene 494591..495058 /locus_tag="PH0553.1n" /db_xref="GeneID:1444443 »CDS 494591..495058 /locus_tag="PH0553.1n" /codon_start=1 /transl_table=11 /product="putative flagella-related protein" /protein_id="NP_877768.1" /db_xref="GI:33359301" /db_xref="GeneID:1444443" /translation="MGFSVSASAAIVFISFLIGLGTLYIAWENSYLEVQAAREFWYSL RTSQLHFDIGNVSISYVNSTHVDVAFTYLGQTLEGKIDVLHNGTYVSSVDVTYLIPGE SYSITIPGGDTSGSLNHLTLAFNNGCVAIIAYHYNGTAYVVDSTSIQCPMEVS"
LOCUS NC_000961 1738505 bp DNA circular BCT 07-JUN-2005DEFINITION Pyrococcus horikoshii OT3, complete genome.…COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BA000001.…
Gène supplémentaire entreles CDSs PH0553 et PH0554
Projets de ré-annotation de génomes bactériens à l’EBI
Gènes en moins/en plus
Enrichissement/correction des annotations fonctionnelles originales(Données UniProt, Genome Ontology, InterPro, etc)
Standardisation/homogénéisation des annotations
Elimination des annotations ‘erronées’ (‘curators’ de UniProt/SWISSProt)
Projet Genome Reviews (GR)
Ajout de CDSs correspondants à des entrées UniProt non annotées sur un génome.
FT CDS complement(3273023..3273601)FT /codon_start=1FT /gene="tdk {UniProt/Swiss-Prot:Q8ECK0}"FT /locus_tag="SO3140 {UniProt/SwissProt:Q8ECK0}"FT /product="Thymidine kinase {UniProt/Swiss-FT Prot:Q8ECK0}"FT /EC_number="2.7.1.21 {UniProt/Swiss-Prot:Q8…}"FT /function="ATP binding {GO:0005524} »FT /function="thymidine kinase activity {GO:0004797}"FT /biological_process="DNA metabolism FT {GO:0006259}"
ID AE014299_GR standard; circular genomic DNA; GRV; 4969803 BP.XXDT 06-JUN-2005 (Rel. 28, Last updated, Version 33)XXDE Shewanella oneidensis (strain MR-1) chromosome, complete sequence.XXCC This Genome Reviews entry was created from entry AE014299.1 in the CC EMBL/GenBank/DDBJ databases on 06 June 2005.…
CDS complement(3273023..3273601) /locus_tag="SO3140" /note="identified by match to PFAM protein family HMM PF00265" /codon_start=1 /transl_table=11 /protein_id="AAN56142.1" /product="thymidine kinase
ID U00096_GR standard; circular genomic DNA; GRV; 4639675 BP.XXDE Escherichia coli (strain K12) chromosome, complete sequence.CC This Genome Reviews entry was created from entry U00096.2 in the CC EMBL/GenBank/DDBJ databases on 06 June 2005.…FT CDS 1486256..1487695FT /gene="aldA"FT /locus_tag="b1415"FT /product="Aldehyde dehydrogenase A"FT /EC_number="1.2.1.21"FT /EC_number="1.2.1.22"FT /function="glycolaldehyde dehydrogenase activity"FT /function="lactaldehyde dehydrogenase activity"FT /biological_process="metabolism"FT /translation="MSVPVQHPMYIDGQFVTWR… »FT CDS complement(1487737..1488389)FT /pseudo="{EMBL:U00096}"FT CDS join(complement(1487997..1488737),FT complement(1487737..1487994))FT /evidence="{BLASTALL 2.2.6/ALIGN 2.0u}"FT /product="Glyceraldehyde-3-phosphate dehydrogenase CFT {UniProt/Swiss-Prot:P33898}"FT /EC_number="1.2.1.12 {UniProt/Swiss-Prot:P33898}"FT /insertion="1487994^1487995,seq:GFT {UniProt/Swiss-Prot:P33898}"FT /transl_except=(pos:1488621..1488623,aa:Lys)FT {UniProt/Swiss-Prot:P33898}FT /translation="MSKVGINGFGRIGRLVLGRLLEVKSNI…
Ajout de CDSs dans le fichier GR : exemple chez E. coli
UniProtKB/Swiss-Prot entry P33898Entered in Swiss-Prot in Release 28, February 1994
CAUTION : In the K12 strain thisgene is disrupted by a stop codonand a frameshift. It seems to beintact in a number of wild strains.
Situation en France et objectif de MicroScope
=> Proposer une «assistance» aux biologistes pour l’annotation de génomes bactériens (automatique et experte)
Les 3 composantes de MicroScope
Pipeline d’annotation automatique (1)
Bases de données relationnelles (2)
Interface graphique d’annotation MaGe (3)
CAATBox
AGMIAL
iANT(S. meliloti,R. solanacearum)
(génomesbactériensd’intérêt agro-alimentaire)
(génomes pathogènesséquencés à l’IP)
(plateforme degénomiqueexploratoire)
MICADO
IMGLib
GenoList
Composante 1 de MicroScope : outils d’annotation structurale
From the AGC groupFrom different authors
AMIMat et AMIGene
AMIMat : caractériser des groupes de gènes homogènes dans l’usage des codons au sein d’un génome bactérien.
Class III(397)
Class I(1791)
Class II(1551)
Class IV(256)
AFCClustering
http://www.genoscope.cns.fr/agc/tools/micheck/html/database_status.html
P(X/X1...Xk)Matrice(s) de transitions
AMIGene : Détecter les gènes de composition atypique / petits gènes http://www.genoscope.cns.fr/agc/tools/amigene
w
phase 1
phase 2
phase 3
start stop
Patterns starts/stops
+ RBS (RBS-Finder)
+ +Heuristique desélection des CDSsles plus probables
ChevauchementsInclusions, …
GeneMark
MICheck : ré-annotation (syntaxique) de génomes bactériensObjectif : Vérifier rapidement si les annotations répertoriées dans les banques de séquences pour un génome donné sont complètes.
http://www.genoscope.cns.fr/agc/tools/micheck
Résultats MICheck quelques génomes bactériens
Genome
Aeropyrumpernix
Nb Gene Uniques AMIGene Uniques Banque
Ori RefSeq GR Ori RefSeq GR Ori RefSeq GR
2694 1843 2694 18 35 18 941 186 941
Corynebacterium glutamicum
3099 2993 3099 15 5 15 65 14 65
Résultats MICheck sur A. pernix (status Reviewed Refseq)
CDS communes CDS UNIQUESBanques
CDS UNIQUESAMIGene
BA00000215651569
1835
941186 NC_000854
Genbank‘original’
(BA000002)
Fichier‘Refseq’
(NC_00854)
APE1077 APE1097rplX APE1087a APE1088a
APE1089
Résultats MICheck quelques génomes bactériens
Genome
Aeropyrumpernix
Nb Gene Uniques AMIGene Uniques Banque
Ori RefSeq GR Ori RefSeq GR Ori RefSeq GR
2694 1843 2694 18 35 18 941 186 941
3497 3502 3497 2 14 2 18 18 18Oceanobacillus
iheyensis
Haemophilus influenzae
Buchnera sp. 572 572 564 0 0 10 0 0 0
1739 1716 1709 2 4 47 4 0 4
Shewanella oneidensis 4757 4438 4630 20 7 150 175 15 175
Corynebacterium glutamicum
3099 2993 3099 15 5 15 65 14 65
Fichier d’annotation original et fichier EMBL (GR)
FT CDS 3264761..3266158FT /codon_start=1FT /gene="dctM {UniProt/TrEMBL:Q8ECK2}"FT /locus_tag="SO3136 {UniProt/TrEMBL:Q8ECK2}"FT /product="C4-dicarboxylate transport protein …FT CDS 3268059..3269438FT /codon_start=1FT /gene="dctD {UniProt/TrEMBL:Q8ECK1}"FT /locus_tag="SO3138 {UniProt/TrEMBL:Q8ECK1}"FT /product="C4-dicarboxylate transportFT transcriptional regulatory proteinFT {UniProt/TrEMBL:Q8ECK1} »FT CDS complement(3273023..3273601)FT /codon_start=1FT /gene="tdk {UniProt/Swiss-Prot:Q8ECK0}"FT /locus_tag="SO3140 {UniProt/SwissProt:Q8ECK0}"FT /product="Thymidine kinase {UniProt/Swiss-FT Prot:Q8ECK0}"FT /EC_number="2.7.1.21 {UniProt/Swiss-Prot:Q8…}"FT /function="ATP binding {GO:0005524} »FT /function="thymidine kinase activity {GO:0004797}"FT /biological_process="DNA metabolism FT {GO:0006259}"FT CDS 3276288..3278438FT /codon_start=1FT /gene="dcp-1 {UniProt/TrEMBL:Q8ECJ9}"FT /locus_tag="SO3142 {UniProt/TrEMBL:Q8ECJ9}"FT /product="Peptidyl-dipeptidase Dcp"FT /function="metalloendopeptidase activity FT {GO:0004222}"FT /biological_process="proteolysis and peptidolysisFT {GO:0006508}"
AE005176_GR gene 3266258..3268062 /gene="dctB" /locus_tag="SO3137" /note="This region contains an authentic frame shift and is not the result of a sequencing artifact; C4-dicarboxylate transport sensor protein, authentic frameshift" gene 3268059..3269438 /gene="dctD" /locus_tag="SO3138" CDS 3268059..3269438 /gene="dctD" /locus_tag="SO3138" /note="similar to GB:X14046, SP:P11049, and PID:29794; identified by sequence similarity; putative" /codon_start=1 /transl_table=11 /product="C4-dicarboxylate transport transcriptional regulatory protein" gene complement(3269514..3272585) /locus_tag="SO3139" /note="This region contains an authentic frame shift and is not the result of a sequencing artifact; conserved hypothetical protein; identified by Glimmer2; putative" gene complement(3273023..3273601) /locus_tag="SO3140" CDS complement(3273023..3273601) /locus_tag="SO3140" /note="identified by match to PFAM protein family HMM PF00265" /codon_start=1 /transl_table=11 /protein_id="AAN56142.1" /product="thymidine kinase gene 3274138..3276066 /locus_tag="SO3141" /note="This region contains a gene with one or more premature stops or frameshifts, and is not the result of a sequencing artifact; cytochrome c, degenerate; similar to GP:3628769; identified by sequence similarity; putative" …
AE005176
/note="This region contains an authentic frame shift and is not the result of a sequencing artifact; C4-dicarboxylate transport sensor protein, authentic frameshift"
/note=" This region contains an authentic frame shift and is not the result of a sequencing artifact; … "
/note="This region contains a gene with one or more premature stops or frameshifts, and is not the result of a sequencing artifact; cytochrome c, degenerate; similar to GP:3628769; identified by sequence similarity; putative"
Résultats MICheck quelques génomes bactériens
Genome
Aeropyrumpernix
Nb Gene Uniques AMIGene Uniques Banque
Ori RefSeq GR Ori RefSeq GR Ori RefSeq GR
2694 1843 2694 18 35 18 941 186 941
3497 3502 3497 2 14 2 18 18 18Oceanobacillus
iheyensis
Haemophilus influenzae
Buchnera sp. 572 572 564 0 0 10 0 0 0
1739 1716 1709 2 4 47 4 0 4
Shewanella oneidensis 4757 4438 4630 20 7 150 175 15 175
Corynebacterium glutamicum
3099 2993 3099 15 5 15 65 14 65
Xanthomonas oryzae
4637 123 76
Dehalococcoidesethenogenes
1592 6 51
Annotation manquante dans le génome de Xanthomonas oryzae
CDS communes CDS UNIQUESBanques
CDS UNIQUESAMIGene
NC_0068344323123 76
XOO3512
Putative vgr-relatedprotein
Similar to rhs element vgr proteinfrom Burkholderia mallei (Q62L24)
XOO3517 XOO3518
Similar to putative membrane proteinfrom Burkholderia pseudomallei
(Q63QC8)
XOO3513
XOO3514
XOO3515
XOO3516
From the AGC groupFrom different authors
Composante 1 de MicroScope : outils d’annotation fonctionnelle
Syntonizer : Groupes de synténies dans les génomes bactériensObjectif : Détecter des groupes de gènes ‘localement’ conserver dans les génomes bactériens.
http://www.genoscope.cns.fr/agc/tools/syntonizer
Rearrangement Fusion Duplication Insertion Inversion
A
B
Synteny Group #2 Synteny Group #1
Reconstition de voies métaboliques
Correspondances simples par EC sur les données d’un génome de référence.
Requêtes dynamiques au serveur de Kyoto.
Voies prédites dans l ’organisme X
Peter Karp (SRI International)
Base métabolique construite pour chaque génome annoté (genomeCyc)
Pathologic : identifie les voies métaboliques à partir des EC +
données métaboliques de MetaCyc. Pathway Hole Filler : recherche de gènes candidats pour les enzymes manquantes.
Relation : numéros EC
Pathway de Référence
Prédiction d’activités enzymatiques (PRIAM)
OrganismeX
• SGBD relationnel (MySQL)SGBD relationnel (MySQL)
Objectif : données d’annotation ‘propres’, cohérentes, à la source des méthodologies de génomique comparative
• Génomes completsGénomes complets (Refseq NCBI (Refseq NCBI + GR+ GR))
Intégration dans PkGDB
Gestion des ‘frameshifts’
Homogénéité des données
Composante 2 de MicroScope : Procaryotic Genome DataBase
PkGDB
Pre-matrix building up
Compare_Annotation‘valids’ CDSs
‘valid’ CDSs (1)
• Check/correction of erroneous CDSs
• Pseudogenes annotation
PkGDB
Databank_AnnotationSet of original
annotations
All the annotated genes :‘valid’ CDSs (1)
+Automatically corrected
CDSs and CDSs which need to be manually corrected
Model gene used to compute coding
prediction curves
Databank file
Integration des données publiques dans PkGDB
Databank_AnnotationSet of original
annotations
Annotation des pseudogènes dans PkGDB
‘fragment’ of CDSs (‘fCDS’ type in PkGDB)
‘complex’ CDS (‘cCDS’ type in PkGDB)
Error type = ‘No3multiple’
kdpB
kdpC
kdpD kdpE speF
gene 622524..624571 /gene="kdpB" /locus_tag="S0610" /note="frameshift" /pseudo /db_xref="GeneID:1077039" gene 624580..625152 /gene="kdpC" /locus_tag="S0611" CDS 624580..625152 /gene="kdpC" /locus_tag="S0611" /function="enzyme; Transport of
small molecules: Cations" /codon_start=1 /transl_table=11 /product="potassium-transporting
ATPase" gene 625145..627825 /gene="kdpD" /locus_tag="S0612" /note="frameshift" /pseudo gene 627822..628507 /gene="kdpE" /locus_tag="S0613" /note="frameshift" /pseudo gene 629197..631394 /gene="speF" /locus_tag="S0614" /note="frameshift" /pseudo …
PkGDB
Compare_AnnotationAll the CDS with the
‘Checked’ Statut
Corrected and validCDSs (2)
AMIMat :Computation of gene
models using FCA and clustering methods
PkGDB
Pre-matrix building up
Compare_Annotation‘valid’ CDSs
‘valid’ CDSs (1)
• Check/correction of erroneous CDSs
• Pseudogenes annotation
PkGDB
Databank_AnnotationSet of original
annotations
All the annotated genes :‘valid’ CDSs (1)
+Automatically corrected
CDSs and CDSs which need to be manually corrected
Model gene used to compute coding
prediction curves
Databank file
Databank_AnnotationSet of original
annotations
Syntonizer :Computation of synteny
group using complete data set of annotations
Integration des données publiques dans PkGDB
• SGBD relationnel (MySQL)SGBD relationnel (MySQL)
Objectif : données d’annotation ‘propres’, cohérentes, à la source des méthodologies de génomique comparative
• Génomes completsGénomes complets (Refseq NCBI (Refseq NCBI + GR+ GR))
Intégration dans PkGDB
Gestion des ‘frameshifts’
Homogénéité des données
Ré-annotation syntaxique
Complétion /correction des données
• Résultats d’analysesRésultats d’analyses : : Intrinsèques : gènes, signaux, répétitions,…
• Génomes nouveauxGénomes nouveaux (projets d’annotation)(projets d’annotation)
Extrinsèques : Blast, InterPro, COG, synténies …
Composante 2 de MicroScope : Procaryotic Genome DataBase
PkGDB
AcinetoScope
YersiniaScope
RhizoScope
BacillusScope ColiScope
FrankiaScope
Composante 2 de MicroScope : bases thématiques
Projet : base de (re)annotation Neisseria
intégration des génomes séquencés disponibles : 2 Neisseria meningitidis serogroup A strain Z2491 + serogroup B MC58 (2000)
1 Neisseria gonorrhoeae (2005)
1 Neisseria meningitidis serogroup C strain FAM18 (en cours au Sanger)
1 Neisseria meningitidis NEM8013 (en cours à l’Institut Pasteur)
ColiScope
NeisseriaScope
NeisseriaScope
Séquences + (re)-annotations+ annotations automatiques+ synténies (> 230 génomes)
MetaCyc
DB objet Ocelot
ADP1Cyc
FalniCyc
BraORSCyc
CenarCyc
MultigénomesCyc
Composante 3 de MicroScope : interface d’annotation MaGe
Début du développement : Oct. 2002
Contexte : annotation du génome de Acinetobacter sp. ADP1 (été 2004)
Developpé par des biologistes impliqués eux même dans l’annotation experte (D. Vallenet)
Interface graphique permettant de visualiser les résultats de synténie entre protéomes bactériens.
Annotation réalisée avec contexte des gènes annotés
Editeur d’annotation ‘modulaire’
Les changements sont adaptés aux projets
Quelques originalité du système MaGe
Comparaison des annotations de plusieurs génomesen utilisant l’organisation des gènes
http://www.genoscope.cns.fr/agc/mage/project _name
Bacterial annotation projects in progress :
project _name = AcinetoScope (Acinetobacter sp. ADP1)
Login name and password are required.
Available re-annotation and annotation projects :
= YersiniaScope (Yersinia species)
= BacillusScope (Bacillus species)
Connection à MaGe
Carte graphique du génome en cours d’annotation
rRNA genes
tRNA genes
Coding prediction curvesobtained with Matrix number 1
CoDing Sequences
Repeat (DNA)
Carte graphique du génome en cours d’annotation
The overall DNA sequence is loaded
The annotation data corresponding to the vizualized region in MaGe (1 bp to 3001 bp) are loaded.
Applet JAVA
Carte graphique du génome en cours d’annotation
Where are the predicted enzymes in theKEGG pathways ?
(complete annotations or only those inthe visualized region)
Kanehisa(Kyoto University)
• Requête dynamique au serveur KEGG• Les enzymes sont coloriées selon le résultat du ‘mapping’ sur les voies métaboliques d’un génome de référence
Carte graphique du génome en cours d’annotations
Connection to the BioCyc metabolic database built in theAGC group (genomeCyc):
PathoLogic pathway analysis-> list of the identified metabolic pathways
In the annotator editor of a gene coding an enzyme-> link to the corresponding metabolic pathway(s)
Peter Karp (SRI International)
Pathway Hole Filler-> list of gene candidates for missing enzymes
Connection à BioCyc sur l’instance de la base du génome en cours d’annotation
Interface graphique des synténies dans MaGe
Low similarity results :from 16.5% to 23.5%
identity
High similarity results :From 52% to 73% identity
Interface graphique des synténies dans MaGe
ugd1.1.1.22
ACIAD0075
5.1.3.132.7.7.2
44.2.1.46
rmlB rmlD rmlArmlC0073
0074
1.1.1.133
Combinaison des synténies et des voies métaboliques
Enzymes encoded by genes in the MaGe region
Enzymes encoded by genes elsewhere in the Acinetobacter genomeAdditional enzymes in E. coli
Connectivité à la base métabolique KEGG
ugd1.1.1.22
ACIAD0075
5.1.3.132.7.7.2
44.2.1.46
rmlB rmlD rmlArmlC0073
0074
1.1.1.133
ACIAD0075
Expert annotation -> “Polysaccharide transport protein”(Automatic annotation -> “Putative transporter”)
Combinaison des synténies et des voies métaboliques
Search for Keywords Homologs and synteny groups Specific genes and regions
Acinetobacter genes in synteny with genes from
PkGDB organisms NCBI RefSeq organisms
AND having no hit with genes from PkGDB organisms NCBI RefSeq organims
(optional)
Exploration des données d’homologie/synténie
MicroScope : Rôle de l’AGC et de l’équipe informatique
Aujourd’hui : 16 projets en cours
Formation et suivit des utilisateurs(une journée : outils d’annotation et interface MaGe)
Développement et maintenance des bases thématiques
Analyse complète d’un génome nouvellement séquencé
Recherche de synténies avec l’ensemble des procaryotes complets
Mise à la disposition des données via l’interface MaGe
Construction de la base BioCyc
Intégration des génomes ‘proches’ dans PkGDB
Optimisation de l’architecture des bases et des ressources machines
Gestion efficace des mises à jour des données
Avancée du “Finishing” : reconstruction des bases
Mise à jour des banques de séquences et des comparaisons
Examples de projets MicroScope
Base deDonnées Bactérie(s) SéquençageCollaborateurs
ColiScopeEscherichia coli B
E. coli D & EEscherichiafergusoni
GenoscopeCommensales et Pathogènes
P. Daelegen (Genoscope, Evry)
E. Denamur (INSERM, Bichat)
LeptoScope
BurkholScope
Leptospira biflexa Pathogène/Saprophyte H.
M. Picardeau & C. Bouchier(IP, Paris)
InstitutPasteur
Burkholderiaspecies
Pathogène E. Fialho (Portugal) Sanger Center
FrankiaScopeFrankia alni
Symbiote de plantesP. Normand (Lyon) Genoscope
Frankia sp. CcI3DOE JGI
Frankia sp. EAN1D. Benson (Univ. Connect, USA)
NeisseriaScope Neisseriameningitidis NEM8013
Pathogène Humain C. Rusniok (LGMP, IP, Paris) InstitutPasteur
L. Tisa (Univ. New H, USA)
CenibaScope
BradyrhizoScope
Cenibacteriumarsenoxidans Environnement
(Métabolise l’arsenic)
P. Bertin(ULP, Strasbourg) Genoscope
Bradyrhizobiumsp. ORS278 Symbiote de plantes
E. Giraud (LSTM, Montpellier) Genoscope
Thiomonas spp.
Bradyrhizobiumsp. BTAi1
Consortium GDR Arsenic
DOE JGIG. Stacey (Univ. Missouri, USA)M. Sadovsky (Univ. Minnesota,USA)
Perspectives pour MicroScope
Interfaces de requêtes multigénomes : Interfaces génériques et spécifiques (requêtes pré-cablées) Interfaces graphiques -> accès à MaGe/BioCyc/Syntonizer
Améliorer l’annotation fonctionnelle automatique :
Détection automatique des évènements de fusion/fission Combinaison synténies/voies métaboliques Recherche automatique de candidats d’enzymes manquantes
Tirer profit de l’annotation experte : Interface permettant de propager l’annotation experte d’un gène aux orthologues ‘forts’.
Formation à l’annotation de génomes bactérienset à la plateforme d’annotation MaGe
4 journées organisées au Genoscope à partir de l’automne 2005 (préparation, au préalable, de la base liée au projet)
-> Les outils d’annotation-> Utilisation de MaGe autour du (des) génomes d’intérêt
Le site Web de MicroScope :
Les acteurs de MicroScope
David Vallenet
Stéphane Cruveiller
A l’Atelier de Génomique Comparative : Zoé Rouy
Aurélie Lajus
Dans le service informatique :
Laurent Sainte-Marthe
Claude Scarpelli
Sylvain Bonneval
… avec la complicité pour les bases BioCyc de : François Lefèvre (équipe de V. Schächter)
Et sans oublier les retours de nos collaborateurs biologistes !
Je vous remercie de votre attention !…
Et pour finir …
Paul Kersey de l’EBI vient nous parler des projets Genome Reviews et Integr8 Jeudi prochain à 11h
dans cette même salle (le 23 Juin)« Interg8 and Genome reviews: integrated views of complete
genomes and proteomes”