AMIN AHMED OUAMEUR

Caractérisation de la famille des transporteurs de folate et de la bioptérine (FBT) chez le parasite protozoaire

Leishmania

Thèse présentée à la Faculté des études supérieures de l'Université Laval

dans le cadre du programme de doctorat en microbiologie-immunologie pour l'obtention du grade de Philosophiae Doctor (Ph.D.)

FACULTE DE MEDECINE UNIVERSITÉ LAVAL

QUÉBEC

2011

©Amin Ahmed Ouameur, 2011

11

Résumé La leishmaniose est une maladie causée par des parasites appartenant au genre

Leishmania. Elle est transmise à l'homme par la piqûre d'un insecte vecteur et est

endémique dans plus de 88 pays où approximativement 350 millions de personnes vivent

dans les zones à risque. À ce jour, aucun vaccin efficace n'est encore disponible pour

prévenir la leishmaniose et le traitement repose actuellement sur la chimiothérapie. Les

composés utilisés pour traiter la maladie sont limités et la plupart d'entre eux sont associés

à des problèmes comme le coût élevé du traitement, les effets secondaires et l'émergence

de souches de parasites résistantes aux médicaments. L'identification de nouvelles cibles

thérapeutiques pour le développement de molécules anti-Leishmania s'avère donc urgente.

La voie métabolique de l'acide folique constitue un champ thérapeutique potentiel d'autant

plus que la découverte chez Leishmania de 13 protéines appartenant à la famille de

transporteurs de folate et de la bioptérine (FBT) permet d'envisager la possibilité de les

exploiter dans un but thérapeutique. Mis à part trois (FT1, FT5 et BT1), les fonctions des

autres protéines de la famille FBT sont inconnues et mon projet de doctorat avait comme

objectif principal de caractériser cette famille et de tenter de trouver des fonctions à ces

transporteurs.

Les objectifs spécifiques de cette thèse étaient 1) de déterminer le profil

d'expression des gènes de la famille FBT aux différentes phases de croissance chez les

deux stades de vie du parasite et chez des mutants résistants au methotrexate (MTX); 2) de

caractériser la fonction d'un nouveau membre de la famille FBT qui était réarrangé chez

des mutants résistants à la sinéfungine (SNF); et 3) d'étudier la localisation subcellulaire

des différents membres de la famille FBT et de quelques protéines de la famille des

transporteurs mitochondriaux (MCF) dans le but d'identifier et de caractériser les

transporteurs de donneurs d'unités monocarbonées, localisés au niveau de la membrane de

la mitochondrie.

L'analyse du profil d'expression de la famille FBT a permis de montrer que

plusieurs gènes FBT sont exprimés préférentiellement en phase stationnaire de croissance,

tandis que seul FT1, le principal transporteur de folate, est exprimé préférentiellement en

I l l

phase logarithmique de croissance ce qui est en accord avec la forte accumulation de folate

durant cette phase de croissance. Aussi, il semblerait que les niveaux d'expression de FT1

dépendent aussi des niveaux de folate dans le milieu de culture. De plus, cette analyse a

permis d'identifier les mécanismes de recombinaison génique impliqués dans l'inactivation

de FT1 chez les souches hautement résistantes au MTX. Par ailleurs, la sélection des

mutants résistants au MTX et à la SNF a permis de caractériser un nouveau membre

(AdoMetTl) de la famille FBT. L'AdoMetTl correspond au transporteur de haute affinité

pour la S-adénosylméthionine. Finalement, les études de localisation protéique ont permis

de déterminer la localisation intracellulaire de trois protéines FBT ainsi que la localisation

mitochondriale des protéines de la MCF.

IV

Abstract

Leishmaniasis is a disease caused by protozoan parasites that belong to the genus

Leishmania. It is transmitted to humans by the bite of an insect vector and is endemic in

over 88 countries, where 12 million people are currently affected and approximately 350

million people are at risk. There is yet no effective vaccine available and treatments rely

exclusively on chemotherapy. The compounds used for the treatment of leishmaniasis are

limited and most of them are associated with problems such as the high cost of treatment,

side effects and the emergence of drug-resistant parasite strains. The discovery of new

therapeutic targets for the development of new anti-Leishmania molecules is thus urgently

needed. The folate metabolic pathway is a potential therapeutic target and the discovery of

a gene family of 13 proteins belonging to the folate/biopterin transporters (FBT) family in

Leishmania suggested new therapeutic strategies. With the exception of three transporters

(FT1, FT5, BTI), the functions of the other FBT proteins were unknown and the main

objective of this thesis was to characterize these transporters and find new functions.

The specific objectives of this thesis were 1) to determine the expression profile of

the FBT family genes during different growth phases and life stages of wild-type parasites

and in methotrexate (MTX)-resistant mutants; 2) to characterize the function of a new

member of the FBT family, which was rearranged in sinefungin (SNF)-resistant mutants;

and 3) to study the subcellular localization of the FBT family proteins and some members

of the mitochondrial carrier family (MCF) in order to identify and characterize the

mitochondrial transporters of one-carbon donors.

The expression profile analysis of the FBT family revealed that several FBT genes

were preferentially expressed in stationary growth phase, whereas only FT1, the main folate

transporter, was preferentially expressed in the logarithmic growth phase, the phase where

accumulation of folate is the highest. Also, it seems that FT1 expression levels are related

to folic acid concentration in the culture medium. Moreover, this analysis revealed that

recombination events are involved in the inactivation ofthe transporter FT1 in the highly

methotrexate-resistant mutants. The selection of mutants resistant to MTX and to SNF led

to the characterization of new members (AdoMetTl) ofthe FBT family. AdoMetTl is the

main high affinity S-adenosylmethionine transporter of Leishmania. Subcellular

localization experiments were useful for the intracellular localization of three FBT proteins

and the mitochondrial localization ofthe MCF proteins.

VI

À mes parents,

Vil

Avant-Propos

Remerciements

Tout d'abord, je tiens à exprimer toute ma gratitude à mon directeur de thèse, le Professeur

Marc Ouellette pour m'avoir accueilli dans son laboratoire, pour la confiance qu'il m'a

accordée tout au long de mon cheminement ainsi que pour l'attention avec laquelle il a

suivi ce travail.

J'adresse mes plus vifs remerciements aux Docteurs Ikram Guizani, Barbara Papadopoulou

et Dave Richard, pour l'honneur qu'ils me font en acceptant d'évaluer cette thèse.

Je remercie également les Instituts de Recherche en Santé du Canada (IRSC) pour leur

support financier.

De plus, j'associe à ces remerciements tous les membres de l'équipe MOU que j 'ai côtoyés

au cours de ces années pour leur soutien et surtout pour les moments de détente partagés

avec eux. Une mention spéciale pour Suzanne Avoine, Gaétan Roy et Dre Danielle Légaré.

Un merci particulier à Wilfried Moreira et Dominic Gagnon pour leur amitié et je

n'oublierai jamais ce qu'ils ont fait pour moi durant toutes ces années de doctorat.

Merci infiniment à mes parents qui m'ont toujours soutenu et encouragé à poursuivre des

études supérieures. Avec l'âge, j 'ai réalisé à quel point mes parents étaient des personnes

extraordinaires car ils ont tout sacrifié pour rendre la vie meilleure à leurs quatre enfants.

Un grand merci à mes deux frères Messaoud et Fouad ainsi qu'à ma sœur Hanane pour leur

fraternité exemplaire et leur soutien permanent.

Enfin, merci à mon épouse et l'amour de ma vie Sihem qui partage ma vie depuis déjà deux

ans. Elle a été très patiente avec moi durant ces deux années et m'a soutenu jusqu'à la fin de

ce travail. En plus, elle m'a amenée de la joie et de la richesse dans ma vie avec la

naissance de notre premier enfant, Yasmine.

vin

Contributions

Cette thèse de doctorat est présentée sous forme de thèse-articles. L'introduction générale

ainsi que la conclusion générale ont été rédigées en français. Les chapitres II, III et IV sont

écrits en langue anglaise pour permettre leur publication dans des journaux scientifiques

internationaux. Les références citées dans chaque article sont placées à la fin de celui-ci.

Les références de l'introduction générale ainsi que de la conclusion générale sont

regroupées et placées à la fin du manuscrit dans la section « Bibliographie ». La liste des

articles ainsi que la contribution de chacun des auteurs sont décrites ci-dessous.

Le manuscrit présenté au chapitre II, intitulé : "Functional analysis and complex gene

rearrangements of the folate/biopterin transporter (FBT) gene family in the protozoan

parasite Leishmania" a été publié dans la revue Molecular and Biochemical Parasitology.

J'ai conçu et réalisé la totalité des expériences présentées dans ce chapitre. Isabelle Girard a

supervisé les étapes d'extraction d'ARN et la synthèse de l'ADNc et a participé dans

l'analyse des résultats de PCR en temps réel. Danielle Légaré a collaboré dans l'étape de la

conception des oligonucleotides et des sondes TaqMan et l'optimisation de la RT-PCR

duplexe en temps réel.

Le manuscrit présenté au chapitre III, intitulé : "The high affinity S-adenosylmethionine

plasma membrane transporter of Leishmania is a member of the folate biopterin transporter

(FBT) family" a été publié dans la revue Journal of Biological Chemistry. Je suis co-

premier auteur dans ce travail. Toutes les étapes de clonage d''AdoMetTl ont été effectuées

par moi-même. Larbi Dridi a généré les cassettes pour l'inactivation génique d''AdoMetTl.

Les expériences que j 'ai effectuées se résument comme suit: Figures 1 et 2, Tableau 1

(IC50), Figure 3 (B et C), Figure 4, Figure 6 et Figure 8. La contribution de Larbi Dridi se

résume comme suit: Tableau 1 (Km et Fmax), Figure 3 (A), Figure 5 et Figure 7.

Le manuscrit présenté au chapitre IV, intitulé: "Intracellular localization of folate/biopterin

transporter (FBT) and mitochondrial carriers family (MCF) proteins in Leishmania''' sera

bientôt soumis pour publication. La grande majorité de clonages et les transfections ont été

effectuées par moi-même. J'ai également effectué les analyses de microscopie à

fluorescence de tous les transfectants. Jean-François Ritt a participé dans le clonage de

IX

quatre gènes FBT (LinJ04.0020-GFP, LinJ10.0390-GFP, LinJ10.1450-GFP et

LinJ35.5120-GFP). Danielle Légaré a contribué dans la révision de l'article.

Table des matières RÉSUMÉ II ABSTRACT iv AVANT-PROPOS VII TABLE DES MATIÈRES X LISTE DES FIGURES xm LISTE DES ABRÉVIATIONS XIV

CHAPITRE I. INTRODUCTION GÉNÉRALE 16

1.1 G É N É R A L I T É S SUR LE PARASITE LEISHMANIA 1 6 1.1.1 INTRODUCTION 16 1.1.2 ÉPIDÉMIOLOGIE ET DISTRIBUTION GÉOGRAPHIQUE 1 7 1.1.3 CYCLE DE VIE ET MORPHOLOGIE 1 9 1.1.4 L E S MANIFESTATIONS CLINIQUES 2 0 1.1.5 L E TRAITEMENT DE LA LEISHMANIOSE 2 2 1.1.5.1 L E S DÉRIVÉS D'ANTIMOINE PENTAVALENT ( S B V ) 2 3 1.1.5.2 PENTAMIDINE 24 1.1.5.3 AMPHOTÉRICINE B 24 1.1.5.4 MlLTEFOSINE 25 1.1.5.5 AUTRES FORMULATIONS 25 1.1.6 L E GÉNOME DE LEISHMANIA 26 1.1.6.1 SÉQUENÇAGE DU GÉNOME 26 1.1.6.2 RÉGULATION DE L'EXPRESSION GÉNIQUE 26

1.2 L E MÉTABOLISME MONOCARBONÉ 28 1.2.1 L E MÉTABOLISME DES FOLATES 2 8 1.2.1.1 INTRODUCTION 28 1.2.1.2 L A BIOSYNTHÈSE DE NOVO DU THF 30 1.2.1.3 RÔLES PHYSIOLOGIQUES DES FOLATES 3 1 1.2.2 L E MÉTABOLISME DE LA S-ADÉNOSYLMÉTHIONINE 3 4 1.2.2.1 INTRODUCTION 34 1.2.2.2 L E CYCLE DE LA METHIONINE ET LA BIOSYNTHÈSE DE L ' A D O M E T 3 5 1.2.2.3 RÔLE PHYSIOLOGIQUE DE L ' A D O M E T 3 6 1.2.3 PATHOLOGIES LIÉES À UNE CARENCE EN FOLATES 3 7 1.2.4 L E S ANTIFOLATES 3 8 1.2.4.1 DÉFINITION 3 8 1.2.4.2 CONTRE LE CANCER 3 8 1.2.4.3 CONTRE LES INFECTIONS BACTÉRIENNES 39 1.2.4.4 CONTRE LES INFECTIONS PARASITAIRES 3 9 1.2.4.6 RÉSISTANCE AUX ANTIFOLATES 4 0

1.3 L E M É T A B O L I S M E MONOCARBONÉ C H E Z LEISHMANIA 4 1 1.3.1 L E MÉTABOLISME DES PTÉRINES 4 1 1.3.1.1 L E TRANSPORT ET LA RÉDUCTION DES PTÉRINES 4 3 1.3.1.2 AUTRES ENZYMES DU MÉTABOLISME DES PTÉRINES 43 1.3.1.3 ROLE PHYSIOLOGIQUE DE LA BIOPTERINE CHEZ LEISHMANIA 4 4 1.3.2 L E MÉTABOLISME DES FOLATES 4 6 1.3.2.1 L A RÉDUCTION ET LA POLYGLUTAMYLATION DES FOLATES 4 6 1.3.2.2 RÔLE PHYSIOLOGIQUE DES FOLATES CHEZ LEISHMANIA 4 7 1.3.3 L E MÉTABOLISME DE LA 5-ADÉNOSYLMÉTHIONINE 4 9

XI

1.3.3.1 LA BIOSYNTHÈSE DE L'ADOMET PAR MAT2 49 1.3.3.2 RÔLE DE L'ADOMET CHEZ LEISHMANIA 50

1.4 LES ANTIFOLATES ET LEISHMANIA 51 1.4.1 LES MÉCANISMES DE RÉSISTANCE AU METHOTREXATE CHEZ LEISHMANIA 51 1.4.1.1 DIMINUTION DE L'ENTRÉE DU MTX 52 1.4.1.2 AMPLIFICATION GÉNIQUE DE LA DHFR-TS 53 1.4.1.3 AMPLIFICATION GÉNIQUE DE PTR1 53 1.4.1.4 ALTÉRATION DE LA POLYGLUTAMYLATION DU MTX 54

1.5 T R A N S P O R T DES DONNEURS D ' U N I T É S MONOCARBONÉES ( F O L A T E , A D O M E T ) 55 1.5.1 CHEZ LES BACTÉRIES 5 5 1.5.1.1 L E TRANSPORTEUR S L R 0 6 4 2 DE LA FAMILLE F B T 5 5 1.5.1.2 L E TRANSPORTEUR F O L T DE LA CLASSE DES TRANSPORTEURS E C F 5 7 1.5.1.3 L E TRANSPORTEUR DE LA S-ADÉNOSYLMÉTHIONINE 5 8 1.5.2 CHEZ LES LEVURES ET LES CHAMPIGNONS 5 9 1.5.2.1 L E TRANSPORTEUR S A M 3 5 9 1.5.2.2 L E TRANSPORTEUR S A M 5 P 6 0 1.5.3 CHEZ LES PROTOZOAIRES 6 1 1.5.4 CHEZ LES PLANTES 6 2 1.5.4.1 L E TRANSPORT DES FOLATES 6 2 1.5.4.2 L E TRANSPORT DE LA S-ADÉNOSYLMÉTHIONINE 6 3 1.5.5 CHEZ LES MAMMIFÈRES 6 4 1.5.5.1 L E TRANSPORT DES FOLATES 6 4 1.5.5.2 L E TRANSPORT DE LA S-ADÉNOSYLMÉTHIONINE 7 0 1.5.6 CHEZ LE VER NEMATODE CAENORHABDITIS ELEGANS 7 2

1.6 L E TRANSPORT DES PTÉRIDINES ET DE L ' A D O M E T C H E Z LEISHMANIA 7 3 1.6.1 L E TRANSPORTEUR B T 1 7 4 1.6.2 LES TRANSPORTEURS DES FOLATES ( F T 5 ET F T 1 ) 7 4 1.6.2.1 STRUCTURE SECONDAIRE DE F T 1 7 5 1.6.2.2 RÉGULATION DE L'EXPRESSION DE F T 1 7 6 1.6.3 L E TRANSPORT DE LA S-ADÉNOSYLMÉTHIONINE CHEZ LEISHMANIA 7 7

1.7 P R O B L É M A T I Q U E , HYPOTHÈSES ET O B J E C T I F S 7 8 1.7.1 PROBLÉMATIQUE 78 1.7.2 HYPOTHÈSES 78 1.7.3 OBJECTIFS 79

CHAPITRE II . ANALYSE FONCTIONNELLE ET RÉARRANGEMENTS GÉNIQUES COMPLEXES DES GÈNES DE LA FAMDLLE DES TRANSPORTEURS DE FOLATE ET DE LA BIOPTÉRINE (FBT) C H E Z LE PARASITE PROTOZOAIRE LEISHMANIA 81 2.1 RÉSUMÉ 81 2.2 ARTICLE 82

CHAPITRE III. LE TRANSPORTEUR DE LA S-ADÉNOSYLMÉTHIONINE DE HAUTE AFFINITÉ LOCALISÉ AU NTVEAU DE LA MEMBRANE PLASMIQUE DU PARASITE LEISHMANIA EST UN M E M B R E DE LA FAMILLE DES TRANSPORTEURS DE FOLATE ET DE LA BIOPTÉRINE (FBT) 114 3.1 RÉSUMÉ 114 3.2 ARTICLE 115

Xll

CHAPITRE IV. LOCALISATION INTRACELLULAIRE DES PROTÉINES DE LA FAJVflLLE DES TRANSPORTEURS DE FOLATE ET DE LA BIOPTÉRINE (FBT) ET DE LA FAMILLE DES TRANSPORTEURS MITOCHONDRIAUX (MCF) CHEZ LEISHMANIA 143 4.1 RÉSUMÉ 143 4.2 ARTICLE 144

CHAPITRE V. CONCLUSION GÉNÉRALE 168 5.1 DISCUSSION 168 5.2 CONCLUSIONS 182

BD3LIOGRAPHTE 184

Xlll

Liste des figures

Figure 1.1. Classification des espèces de Leishmania 17 Figure 1.2. Distribution géographique des leishmanioses 18 Figure 1.3. Cycle de vie du parasite Leishmania 20 Figure 1.4. Manifestations cliniques des différentes formes de leishmanioses 21 Figure 1.5. Organisation génique et maturation des messagers chez Leishmania 27 Figure 1.6. Structure chimique des différentes formes des folates et de l'antifolate

methotrexate 29 Figure 1.7. La biosynthèse de novo des ptérines et des folates 31 Figure 1.8. Rôle des folates dans le métabolisme monocarboné 33 Figure 1.9. Structure de la .V-adénosylmethionine (AdoMet), de la 5-adénosyl-

homocystéine (AdoHcy) et de la sinéfungine (SNF) 34 Figure 1.10. Le métabolisme de la methionine et de la 5-adénosylméthionine 36 Figure 1.11. Le métabolisme monocarboné chez le parasite Leishmania 42 Figure 1.12. Représentation de la structure secondaire du slr0642 56 Figure 1.13. Organisation schématique des transporteurs ECF 57 Figure 1.14. Modèle topologique des membres de la MCF 61 Figure 1.15. Topologle membranaire du transporteur de folate réduit 66 Figure 1.16. Structure secondaire prédite du PCFT 68 Figure 1.17. Structure secondaire prédite du transporteur folt-1 73 Figure 1.18. Topologie membranaire prédite du transporteur FT1 76

XIV

Liste des abréviations

ADN acide désoxyribonucléique AdoMet S-adénosylméthionine AdoHcy 5-adénosylhomocystéine AICARFT « aminoimidazolcarboxamide ribonucleotide formyltransferase » AQP1 aquaglycoprotéine 1 ARN acide ribonucléique ARNm ARN messager ATP adenine triphosphate AmB amphotéricine B BH2 dihydrobioptérine BH4 tétrahydrobioptérine BHMT bétaïne-homocystéineméthyltransférase BT1 « bioptérine transporter 1» Cl monocarboné CBS cystathionine P-synthase CGC complexe enzymatique du clivage de la glycine DHCH méthylènetétrahydrofolatedéshydrogénase/méthényltétrahydrofolate

cyclohydrolase DHF dihydrofolate DHFR dihydrofolate reductase DHFS dihydrofolate synthase DHPR dihydroptéroate reductase DHPS dihydroptéroate synthase dTMP desoxythymine monophosphate (thymidilate) dUMP desoxyuridine monophosphate (urydilate) ECF « energy-coupling factor » FBT « folate and bioptérine transporter » FTL formyl-tétrahydrofolate ligase FPGS folylpolyglutamate synthetase FRs « folate receptors » FT « folate transporter » yGCS y-glutamyl-cystéine synthase GARFT « glycinamide ribonucleotide formyltransferase » GGH gamma-glutamyl hydrolase GPI glycosylphosphatidylinositol GTP guanosinetriphosphate Hcy homocysteine IC50 « 50 % inhibitory concentration » Km constante d'affinité LDI « Leishmania DNA 1 » mM millimolaire MAT methionine adénosyltransférase MCF « mitochondrial carrier family »

XV

MFS MFT MTHFR MTX MS NADPH nM NO NOS pABA PCFT PTR1 qBH2 QDPR RFC SAHH SbV Sblll SHMT SLC THF TMP TS pM VIH Vmax

« major facilitator superfamily » méthionyl-tRNA formy-transferase méthyl tétrahydrofolate reductase methotrexate methionine synthase nicotinamide adenine dinucléotide phosphate nanomolaire « nitric oxyde » « nitric oxyde synthase » acide para-aminobenzoique « proton-coupled folate transporter » ptérine reductase 1 dihydrobioptérine quinonoi'de dihydrobioptérine quinonoi'de reductase « reduced folate carrier » .S-adénosylhomocystéine hydrolase antimoine pentavalent antimoine trivalent serine hydroxyméthyltransférase « solute carrier » tétrahydrofolate trimethoprim thymidilate synthase micromolaire virus d'immunodéficience humain vitesse maximale

16

Chapitre I. Introduction générale

1.1 Généralités sur le parasite Leishmania

1.1.1 Introduction

Le parasite Leishmania est un eucaryote unicellulaire appartenant à l'ordre des

Kinetoplastidae et à la famille des Trypanosomatidae. Ce protiste se transmet à l'homme

par la piqûre d'un insecte femelle, appelé phlébotome (ou mouche des sables), appartenant

au genre Phlebotomus ou Lutzomyia. Plusieurs espèces du genre Leishmania peuvent

infecter l'homme et causer des manifestations cliniques, ou des leishmanioses, allant des

formes cutanées qui guérissent spontanément aux formes viscérales, mortelles en l'absence

de traitement (140, 324). Initialement, la classification des espèces de Leishmania était

basée sur des critères extrinsèques comme les manifestations cliniques, la distribution

géographique et la morphologie. Des techniques de biologie moléculaire et biochimique ont

par la suite été utilisées pour mieux définir les espèces (183). Ainsi, les espèces de

Leishmania qui infectent les mammifères ont été classées en 2 sous-genres, Leishmania et

Viannia, selon la position des parasites au niveau de l'intestin du vecteur, tandis que celles

infectant les reptiles (e.g. L. tarentolae) appartiennent au sous-genre Sauroleishmania (Fig.

1.1). Le sous-genre Viannia comprend des espèces retrouvées uniquement dans le Nouveau

monde (e.g. L. braziliensis, L. panamensis) tandis que le sous-genre Leishmania comprend

des espèces retrouvées dans le Nouveau monde (e.g. L. mexicana) et l'Ancien monde (e.g.

L. infantum, L. major) (23). Pour ce qui est de la distribution du vecteur, le genre

Phlebotomus est prédominant dans l'Ancien monde alors que le genre Lutzomyia est

prédominant dans le Nouveau monde. Parmi les 500 espèces de phlébotomes connues,

seulement 31 ont été positivement identifiées comme vecteurs des espèces pathogènes de

Leishmania et 43 comme vecteurs potentiels (163, 164).

17

Ordre

Famille

Kinetoplastidae

I Trypanosomatidae

,1 i 1 1 i r 1 1 1 1

G e n r e Crithidia Leplomonas Herpetomonas Blastocrithidia Leishmania Sauroleishmania Trypanosoma Phytomonas Endotrypanum

, ' ' = = -Sous-genre Leishmania

i H—i 1 1 Complexe L. donovani L. tropica L. major L. aethiopica L. mexicana

Espèce i i i

L. archibaldi L. chagasi L. donovani L. infantum

L. killicki L, tropica

L. major L. aethiopica L. amazonensis L. gamhami L. mexicana L. pifanoi L. venezuelensis

— I Viannia

I I L. braziliensis L. guyanensis

I I L. braziliensis L. guyanensis L. peruviana L. panamensis

L. tarentolae

Figure 1.1. Classification des espèces de Leishmania. (Inspiré de (23)).

1.1.2 Epidemiologic et distribution géographique

La leishmaniose, une maladie dite négligée, est un problème de santé publique

majeur dans les pays pauvres du globe (4). La plupart du temps, la leishmaniose est

transmise à l'homme à partir d'animaux (leishmaniose zoonotique) mais il existe

néanmoins des formes transmises d'une personne à l'autre (leishmaniose anthroponotique)

comme dans le cas de l'Inde où l'homme à été identifié comme étant l'unique réservoir.

Les leishmanioses sont endémiques dans plusieurs pays situés dans les régions tropicales et

subtropicales du globe. On distingue deux grandes subdivisions géographiques, l'Ancien

monde (Afrique, Asie, Europe) et le Nouveau monde (Amérique du Nord, du Sud et

Centrale). La leishmaniose est endémique dans environ 88 pays où approximativement 350

millions de personnes vivent dans ces zones à risque (Fig. 1.2). On estime qu'environ 12

millions de personnes sont atteintes, avec une incidence annuelle de 500 000 nouveaux cas

de leishmanioses viscérales (90 % des cas se rencontrent en Inde, au Bangladesh, au Népal,

au Soudan et au Brésil) et entre 1 et 1.5 millions cas de leishmanioses cutanées (90 % des

cas se rencontrent en Afghanistan, en Algérie, au Brésil, en Iran, au Pérou, en Arabie

18

Saoudite et au Soudan) (79, 133). De plus, l'émergence des cas de co-infection

LeishmaniafVUî dans différentes parties du monde est un facteur qui vient aggraver la

situation. En effet, une infection au VIH augmente le risque de développer une

leishmaniose viscérale de 100 à 2000 fois dans les zones endémiques (3).

LEISHMANIASIS ^ - x ^ v - > i * ^

\

mÊÊÊ '^••W^J V

\

mÊÊÊ r**v îw^K

\

mÊÊÊ MgF-

\

sa &Œ,

* ;

^

\

à;-' ' ' u:.> \ t

Visceral

Cutaneous / Mucocutaneous

Visceral + Cutaneous 1 Mucocutaneo

^ L 12 million people infected \M ^ f 350 million people at risk i B [ * r us

Figure 1.2. Distribution géographique des leishmanioses. (Tiré de (133)).

Les zones touchées par la leishmaniose viscérale sont indiquées en vert tandis que celles touchées par la leishmaniose cutanée sont indiquées en rouge. Les zones en violet sont autant touchées par les leishmanioses viscérales que cutanées.

19

1.1.3 Cycle de vie et morphologie

Les parasites Leishmania possèdent un cycle de vie dimorphique caractéristique de

l'hôte dans lequel ils évoluent (Fig. 1.3). Lorsqu'ils se trouvent dans le tractus digestif de

l'insecte vecteur, ils sont sous une forme dite promastigote, une forme allongée (15 à 20

um), flagellée et mobile. Lorsque le phlébotome se prépare à transmettre les parasites à un

hôte mammifère, les promastigotes se différencient à l'intérieur du tractus digestif de

l'insecte en passant du stade procyclique (phase de croissance rapide des promastigotes et

forme non infectieuse du parasite) vers le stade métacyclique (forme mature et infectieuse

du parasite) (325). Cette forme métacyclique est caractérisée par l'expression de protéines

spécifiques (221). Lors de la piqûre par le phlébotome les parasites métacycliques sont

inoculés dans l'hôte vertébré puis reconnus par les cellules du système immunitaire,

notamment les macrophages qui phagocytent les parasites opsonisés par les molécules du

complément. Une fois à l'intérieur du phagolysosome, les parasites se transforment au

stade amastigote, caractérisé par une apparence sphérique de plus petite taille (2 à 5 pm).

La différenciation de la forme promastigote métacyclique vers la forme amastigote est

induite par les changements de température et de pH (insecte : 25°C et pH neutre;

phagolysosome : 37°C et pH acide) (422). Il est possible de faire croître in vitro les divers

stades de differentiation de plusieurs espèces de Leishmania dans des milieux de culture

relativement complexes. Les amastigotes se multiplient dans le phagolysosome par

scissiparité jusqu'à l'éclatement de la cellule et vont ensuite coloniser d'autres

macrophages sains avoisinants. Le cycle de vie est complété lorsqu'un nouveau

phlébotome ingère les amastigotes libres dans le sang de l'hôte mammifère infecté lors de

son repas.

20

Uptake

0®

Proliferation In the midgut

Figure 1.3. Cycle de vie du parasite Leishmania. (Tiré de (133)).

La transmission de Leishmania à un hôte vertébré se fait par une piqûre de la mouche des sables. Ainsi, les parasites sous forme promastigotes sont injectés dans la circulation sanguine. Les promastigotes seront phagocytés par les macrophages puis, à l'intérieur du phagolysosome, se différencient en amastigotes. Ces derniers se multiplient par scissiparité jusqu'à l'éclatement de la cellule et iront infecter d'autres macrophages sains avoisinants ou seront ingérés à nouveau par un phlébotome afin de compléter le cycle.

1.1.4 Les manifestations cliniques

On distingue trois principales manifestations cliniques; la leishmaniose cutanée, la

leishmaniose mucocutanée et la leishmaniose viscérale (Fig. 1.4). Sur une vingtaine

d'espèces pathogènes du genre Leishmania, on peut globalement distinguer deux espèces à

tropisme viscéral (L. donovani et L. infantum), c'est-à-dire responsables de la leishmaniose

21

viscérale. Pratiquement toutes les autres espèces sont dermotropes, responsables de la

leishmaniose cutanée. L. braziliensis, et plus rarement L. panamensis, sont connues pour

leur localisation secondaire aux muqueuses faciales (140). Les manifestations cliniques ne

dépendent pas seulement de l'espèce de Leishmania en cause, mais également de la santé

immunitaire de l'hôte et de son profil génétique.

Figure 1.4. Manifestations cliniques des différentes formes de leishmanioses. (Tiré de (23)).

A, leishmaniose cutanée; B, leishmaniose mucocutanée; C, leishmaniose viscérale

La leishmaniose cutanée (Fig. 1.4 A) est causée par plusieurs espèces de

Leishmania de l'Ancien et du Nouveau monde (e.g. L. major, L. tropica, L. aethiopica, L.

mexicana, L. amazonensis, L. panamensis, L. guyanensis). La maladie est caractérisée par

une ulcération de la peau au niveau du site d'inoculation. La lésion peut évoluer en

quelques mois vers une guérison spontanée, mais laissera une cicatrice indélébile. La

leishmaniose cutanée peut aussi être diffuse, c'est-à-dire qu'on assiste à une dissémination

des lésions. Cette forme de la maladie est plus grave et affecte plus souvent les personnes

immunosupprimées qui sont incapables de guérir spontanément et qui ont tendance à

22

rechuter après le traitement. La leishmaniose cutanée diffuse est causée principalement par

L. amazonensis et L. guyanensis.

La leishmaniose mucocutanée (Fig. 1.4 B) se manifeste par des lésions pouvant

conduire à une destruction étendue des muqueuses du visage et provoquant ainsi une

défiguration permanente du patient. Elle est principalement causée par L. braziliensis et la

cause de décès est souvent attribuable à une infection bactérienne opportuniste des voies

respiratoires.

La leishmaniose viscérale (Fig. 1.4 C) est causée principalement par deux espèces,

L. infantum et L. donovani. En Amérique du sud, L. infantum est connue sous le nom de L.

chagasi, mais elles sont génétiquement identiques (23). La leishmaniose viscérale est la

manifestation clinique la plus sévère et elle est mortelle en absence de traitement. Elle

s'attaque aux organes internes tels que la rate et le foie et se caractérise notamment par des

poussées irrégulières de fièvre, une perte de poids importante, une hépatosplénomégalie et

de l'anémie. Une autre forme de leishmaniose viscérale appelée leishmaniose dermique

post kala-azar (PKDL) peut survenir quelques années plus tard chez les patients qui n'ont

pas été traités adéquatement pour la première forme. La PKDL se caractérise par une

éruption cutanée sur tout le corps et est très longue à traiter (332).

1.1.5 Le traitement de la leishmaniose

Aucun vaccin efficace n'est présentement disponible pour combattre les

leishmanioses humaines et le traitement actuel repose essentiellement sur la chimiothérapie.

En matière de prévention vaccinale, plusieurs candidats ont été développés et testés en

prophylaxie chez des modèles animaux et chez l'humain. Des essais cliniques ont été

pratiqués chez l'homme avec des vaccins de première génération constitués de

promastigotes tués et de fractions antigéniques, accompagnés ou non d'adjuvant (BCG),

mais l'efficacité obtenue est souvent insuffisante (revue dans (161, 265)). Encore

aujourd'hui, plusieurs stratégies de vaccination sont en développement contre les

leishmanioses cutanées et viscérales chez les canidés et chez l'humain. En attendant un

vaccin, le contrôle préventif de la leishmaniose repose sur la lutte contre les vecteurs dans

les zones endémiques à l'aide d'insecticides ou de moustiquaires imprégnés d'insecticide

23

ainsi que par le contrôle des réservoirs, animaux domestiques en particulier, par l'utilisation

de colliers imprégnés d'insecticide.

L'arsenal de médicaments disponible pour contrer la leishmaniose est très restreint

et le traitement repose en première intention sur des dérivés d'antimoine pentavalent (SbV).

Dans les cas de non-réponse au traitement par l'antimoine, d'autres médicaments utilisés en

seconde ligne de défense (e.g. la pentamidine, l'amphotéricine B, la miltefosine) prennent

le relais (revue dans (68, 260)).

1.1.5.1 Les dérivés d'antimoine pentavalent (SbV)

La classe de médicaments à base d'antimoine pentavalent (SbV) constitue la

première ligne de défense contre la majorité des formes de leishmanioses et est utilisée

depuis plus de 50 ans. Elle est commercialisée sous le nom de Glucantime® (ou

méthylglucamine antimoine) et de Pentostam® (ou stibogluconate de sodium). Bien que le

mode d'action de l'antimoine pentavalent ne soit pas encore bien défini, il est généralement

reconnu qu'il s'agit d'un pro-médicament qui doit être réduit en sa forme active (SblII)

pour acquérir son activité antileishmanienne (348). Des données récentes suggèrent que

l'antimoine interfère avec le métabolisme des thiols en augmentant leur efflux en plus

d'inhiber la reductase, une enzyme responsable du maintien du trypanothione sous sa forme

réduite chez le parasite (412). Il a été démontré pour la première fois chez Leishmania que

le transport de SblII se fait par l'intermédiaire d'une aquaglycéroporine (AQP1) (120) et

que ce transporteur membranaire jouerait un rôle important dans la résistance à l'antimoine

(210). Il est à noter que la toxicité et les effets secondaires parfois graves des dérivés

d'antimoine pentavalent sont bien connus ainsi que la résistance parasitaire croissante à ces

composés. La résistance développée par Leishmania envers les médicaments de première

ligne dans certaines régions du globe, comme en Inde, est de plus en plus préoccupante

(363) et les mécanismes de résistance chez Leishmania sont étudiés de façon intensive (69,

260).

24

1.1.5.2 Pentamidine

La pentamidine est une diamidine aromatique utilisée comme médicament de

seconde ligne pour le traitement des leishmanioses viscérales réfractaires au traitement par

les dérivés d'antimoine (363). Bien que la cible cellulaire de la pentamidine ne soit pas

encore connue, certaines évidences suggèrent que la pentamidine pourrait cibler la

mitochondrie (24, 233, 392). Des études récentes ont mis en évidence la contribution des

transporteurs de pentamidine dans le phénomène de résistance (42, 66). En raison d'une

importante toxicité (hypotension, hypoglycémie, diabète, néphrotoxicité) et d'une

diminution de son efficacité liée à une résistance croissante, notamment en Inde (363),

l'utilisation de la pentamidine devient de plus en plus limitée.

1.1.5.3 Amphotéricine B

L'amphotéricine B (AmB) est un antibiotique polyene utilisé initialement pour

traiter les infections fongiques systémiques. Ce médicament a été utilisé en seconde

intention pour le traitement des leishmanioses depuis les années 1960. Il interagit avec les

sterols des membranes plasmiques et préférentiellement avec l'ergostérol, causant des

lésions cellulaires par altération des membranes. Comme pour les champignons,

l'ergostérol est aussi présent au niveau de la membrane plasmique de Leishmania (113), ce

qui explique l'efficacité de l'amphotéricine B contre la leishmaniose. De nos jours l'AmB

est utilisé sous forme liposomale, beaucoup plus efficace et moins toxique, en particulier

dans le cas de leishmanioses viscérales résistantes à l'antimoine (365). Cependant,

l'amphotéricine B, sous sa forme liposomale, est financièrement hors de portée pour les

populations démunies qui malheureusement sont les plus touchées. Bien que la résistance à

l'AmB ne semble pas poser de problème pour le moment chez les souches cliniques, les

études in vitro démontrent que l'émergence de la résistance pourrait être associée à un

changement au niveau de la fluidité membranaire en remplaçant l'ergostérol par un

précurseur de moindre affinité avec le médicament (216).

25

1.1.5.4 Miltefosine

La miltefosine (introduite dans les années 1980) est un dérivé de la phosphocholine

utilisé initialement pour traiter le cancer du sein. Elle est utilisée par voie orale dans le

traitement de la leishmaniose viscérale (364) et a aussi été utilisée avec succès pour le

traitement des cas résistants à l'antimoine (366). Considérée comme sûre, provoquant peu

d'effets secondaires et permettant ainsi d'obtenir des taux de guérison atteignant 97% (35),

la miltefosine a été homologuée en Inde en 2002 et en Colombie en 2005 (68). Le

mécanisme d'action de la miltefosine reste mal connu, il semblerait qu'elle interfère avec le

métabolisme des alkyl-lipides et la biosynthèse des phospholipides (201, 302). En raison de

l'introduction récente de la miltefosine sur le terrain, la résistance des souches cliniques n'a

pas encore été rapportée. Cependant, la résistance peut facilement être obtenue in vitro, ce

qui permet de présager le développement de ce phénomène sur le terrain. La caractérisation

des mutants résistants à la miltefosine a permis d'associer la résistance à un défaut dans

l'accumulation du médicament à l'intérieur de la cellule. Ce phénomène serait causé par

des mutations inactivant son transporteur situé au niveau de la membrane plasmique (284,

285, 346).

1.1.5.5 Autres formulations

D'autres molécules qui viennent renforcer l'arsenal thérapeutique sont en phase

clinique de développement, mais elles sont malheureusement peu nombreuses (revue dans

(68)). Les principales molécules sont la paromomycine (en phase clinique III) et la

sitamaquine (en phase clinique II). La paromomycine est utilisée en monothérapie ou en

association avec l'antimoine dans le traitement des leishmanioses cutanées et viscérales. La

sitamaquine, connu aussi sous le nom de WR6026, est utilisée en monothérapie pour le

traitement de la leishmaniose viscérale. La résistance ne présente pas encrore de problème

pour la paromomycine et la sitamaquine vue que leur utilisation est limitée en clinique.

Cependant, la résistance à la paromomycine a pu être observée in vitro et est associée à une

diminution du transport de la molécule (205). L'activité de la paromomycine contre

Leishmania semblerait être dirigée contre les ribosomes (208) et certaines enzymes

mitochondriales (206), en plus de causer une altération au niveau de la fluidité

26

membranaire et du métabolisme lipidique (207). Plus d'études sont nécessaires pour mieux

comprendre le mode d'action de la sitamaquine et les mécanismes de résistance associés à

cette molécule.

1.1.6 Le génome de Leishmania

1.1.6.1 Séquençage du génome

Le séquençage du génome de Leishmania major Friedlin (153) a été complété en

2005, suivi par le séquençage des génomes de Leishmania infantum et Leishmania

braziliensis qui a été achevé en 2007 (278). Ainsi, Leishmania major et Leishmania

infantum contiennent 36 paires de chromosomes, tandis que Leishmania braziliensis n'en

contient que 35, dû à la fusion des chromosomes 20 et 34 dans ce dernier (44). Le nombre

total de gènes codants pour des protéines est de 8298 pour Leishmania major (dont 97

pseudogènes), de 8154 pour Leishmania infantum (dont 41 pseudogènes) et de 8153 pour

Leishmania braziliensis (dont 161 pseudogènes). L'analyse des séquences du génome a

révélé une densité de gène de 1 gène par 3.5 kb et un contenu en bases G-C d'environ 60

%. Les gènes codants pour des protéines sont dépourvus d'introns et les fonctions chez

seulement 36% d'entre eux ont été prédites (153). Malgré les 20 à 200 millions d'années

qui séparent les espèces des deux genres Leishmania et Viannia, la synthénie est bien

conservée entre les trois génomes (278). Une particularité remarquable chez les

Trypanosomatidae, notamment chez Leishmania, est l'organisation des gènes en grandes

unités polycistroniques (242). Par exemple, le chromosome 1 de Leishmania major contient

deux larges unités polycistroniques divergentes, ce qui veut dire que leur ARNm est

transcrit de façon divergente vers les telomeres; une unité de 29 gènes située sur un brin

d'ADN et l'autre de 50 gènes sur le brin complémentaire. D'autres chromosomes peuvent

avoir des unités convergentes ou une combinaison d'unités convergentes et divergentes

(242).

1.1.6.2 Régulation de l'expression génique

La régulation de l'expression des gènes chez Leishmania, un organisme qui a

divergé très tôt au cours de l'évolution des eukaryotes, se fait principalement au niveau

27

post-transcriptionnel (63, 64). En effet, même si la transcription de plusieurs ARNm par

une polymerase de type ARN pol II a été démontrée chez Leishmania, aucune séquence

promotrice n'a été détectée en amont de ces gènes. Ainsi, chez Leishmania, les larges

unités polycistroniques contenant des gènes organisés en tandem sont initialement

transcrites par l'ARN pol II en longs ARN pré-messagers (Fig. 1.5). La maturation de ces

ARN pré-messagers se fait par deux mécanismes majeurs, soit l'épissage en trans (ajout

d'un mini exon de 39 nucleotides en 5' du gène) et la polyadénylation en 3' du gène. Tous

les ARNm chez Leishmania possèdent ce mini-exon de 39 nucleotides à leur extrémité 5' et

son addition est étroitement associée à la polyadénylation et fournit également la structure

de coiffe (cap) (63, 64). Des éléments situés dans les séquences 3' non-traduites (3'UTRs)

des transcrits interviennent dans la régulation de l'expression des gènes en modulant la

stabilité des ARN messagers ou l'efficacité de la traduction (39, 43, 224, 235, 236). La

modulation de l'expression génique chez des parasites sélectionnés pour la résistance aux

médicaments est associée à des événements de deletion ou d'amplification géniques ainsi

qu'aux changements du nombre de copie de chromosomes (189, 384).

ADN GÉNOMIQUE

: IMUUU* < «

ARN PRE-MESSAGER

39 nt mini-exon

Transcription

nnnnnnnn N M — H -

> »

< « - «Vi n „ r i n n»»» Copies de SL-ARN (chromosome II)

Épissage < pofyadénylat

ARNm MATURES

RÉGULATION POST-TRANSCRIPTIONNEUE C Stabilité des ARNm

Modulation de la traduction des ARNm

Figure 1.5. Organisation génique et maturation des messagers chez Leishmania. (Tiré de (263)).

28

1.2 Le métabolisme monocarboné

Le métabolisme monocarboné (ou métabolisme Cl) désigne l'ensemble des

réactions métaboliques qui nécessitent le transfert d'unités à un carbone (revue dans (62,

104, 374)). Deux cofacteurs jouent un rôle essentiel dans le métabolisme Cl; les folates et

la S-adénosylméthionine (AdoMet). Le métabolisme de ces deux cofacteurs est étroitement

connecté puisque les folates sont impliqués dans la synthèse de l'AdoMet, le donneur

universel des groupements méthyl ((62, 104, 374)). Par ailleurs, le métabolisme des folates

est d'un grand intérêt pour les industries pharmaceutiques puisqu'il a été exploité avec

succès pour le traitement de plusieurs maladies comme le cancer et les infections

microbiennes à l'aide des antifolates (section 1.2.4). Dans cette section du chapitre I nous

allons introduire le métabolisme monocarboné chez les eucaryotes supérieurs, notamment

chez les mammifères. Le transport des folates et de l'AdoMet sera traité dans la section 1.5.

1.2.1 Le métabolisme des folates

1.2.1.1 Introduction

Folate(s) est un terme générique qui désigne un ensemble de molécules qui ont pour

structure de base l'acide folique (Fig. 1.6). L'acide folique (AF), appelé également vitamine

BQ OU acide ptéroylglutamique, est la forme synthétique des folates et existe sous forme

monoglutamate. L'AF est une molécule tripartite composée d'un noyau de ptérine, une

molécule d'acide para-aminobenzoïque (pABA) et une molécule de glutamate. La forme

active de l'acide folique dans la cellule est sa forme réduite, le tétrahydrofolate (THF) (337,

350, 395). Le THF joue un rôle de donneur et d'accepteur d'unités monocarbonnées (Cl),

principalement sous la forme de groupements méthylène (-CH2-), formyl (-CHO) et méthyl

(-CH3). Ces derniers sont impliqués dans la biosynthèse de la thymidine, la conversion de

la serine en glycine, la biosynthèse des purines et du formyl-méthionyl-ARNt ainsi que la

methylation de 1'homocysteine en methionine. Les trois principaux donneurs d'unités Cl

dans la cellule sont la serine, la glycine et le formate. Chez les mammifères, le catabolisme

de l'histidine, de la choline et des purines est également source d'unités Cl (104). Dans le

sérum, les folates sont sous formes monoglutamylées, tandis que les folates intracellulaires

existent sous forme polyglutamylée (220, 229). La chaine polyglutamate permet

29

d'augmenter la rétention des folates dans les différents compartiments de la cellule ainsi

que leur affinité envers les enzymes folate-dépendantes ce qui augmente leur stabilité

(337).

Ptérine p-ABA Glutamate

OH

" ifNY C H - N H

O r = \ Il

A\ / ) - C - \ H H — CH

CH Acide folique

COOH

COOH.

Forme oxidee de folate

H , N ^ % ^ N

O COOH

v " !

N ^ ^ C H j - M H - t ^ ^ - C - N H - C H

ÇH, COOH

5-CHj-THF

OH

H ^ N ^ N ^

O COOH Il I

^ - C - N H - Ç H

CH,

CH, I COOH

10-CHO-THF

<ÇH °»v$rNr\ //

1 N H 5,10-CH2-THF

O COOH Il I C —NH —CH

I CH,

ÇH, COOH

v Formes réduites r de folate

NH,

V r S i ^ N *

CH, 0 COOH I

- C H I

CH,

CH

Antifolate (inhibiteur de la DHFR)

Methotrexate Ç H, COOH

Figure 1.6. Structure chimique des différentes formes des folates et de l'antifolate methotrexate

La molécule d'acide folique (AF) constitue la structure de base des folates. Elle est composée d'un noyau de ptérine, d'une molécule d'acide para-aminobenzoïque (pABA) et d'une molécule de glutamate. Les principales unités Cl (-CH3, -CHO, -CH2-) portées par le tétrahydrofolate (THF) sont indiquées dans un cercle gris. Le methotrexate, un inhibiteur de la dihydrofolate reductase (DHFR), est un analogue structural de l'AF.

30

1.2.1.2 La biosynthèse de novo du THF

Toutes les cellules, procaryotes ou eucaryotes, ont besoin des folates pour leur

croissance et leur survie. Les cellules des mammifères ne possèdent pas la totalité des

enzymes nécessaires à la biosynthèse du THF. En effet, elles n'ont que la capacité de

synthétiser la molécule de ptérine sous forme réduite, la tétrahydrobioptérine (BH4) (revue

dans (194, 373)). Les plantes, les levures, les champignons, la plupart des bactéries et

quelques parasites (e.g. Plasmodium falciparum, Toxoplasma gondii) ont la capacité de

synthétiser de novo le THF (259, 307). Les cellules des mammifères sont donc autotrophes

pour la bioptérine et auxotrophes pour les folates qu'elles doivent obligatoirement importer

du milieu extérieur.

Les différentes étapes de la voie de biosynthèse du THF sont illustrées dans la

figure 1.7. Elle débute avec une molécule de guanosine triphosphate (GTP) qui est

convertie en noyau de ptéridine par la GTP cyclohydrolase I (GTPCH). Après deux

réactions enzymatiques catalysées respectivement par la 6-pyruvoyltétrahydroptérine

synthase (PTPS) et la sepiapterine reductase (SR), une molécule de tétrahydrobioptérine

(BH4) est obtenue chez les mammifères. Cette molécule joue un rôle important dans la

cellule puisqu'elle sert de cofacteur lors de la synthèse d'oxyde nitrique (NO) et est

également impliquée dans l'hydroxylation des acides aminés aromatiques (e.g.

phenylalanine, tryptophane, tyrosine) et le catabolisme des lipides (194, 373).

Chez les organismes autotrophes pour les folates comme les bactéries, la molécule

de ptéridine obtenue à la suite d'une série de réactions enzymatiques est conjuguée avec

une molécule d'acide para-aminobenzoïque (pABA), dérivée à l'origine de la voie du

chorismate, pour former une molécule de dihydroptéroate. Cette conjugaison est catalysée

par la dihydroptéroate synthase (DHPS). Une autre enzyme, la dihydrofolate synthase

(DHFS), conjugue une molécule d'acide glutamique avec le dihydroptéroate pour former

une molécule de dihydrofolate (DHF). Pour être active, cette dernière doit subir une

seconde réduction par la dihydrofolate reductase (DHFR) afin d'obtenir le tétrahydrofolate

(THF). La dernière étape de la voie de biosynthèse du THF consiste à l'ajout d'une ou de

plusieurs molécules de glutamate par la folylpolyglutamate synthase (FPGS) (Fig. 1.7).

31

Micro-organismes Mammifères GTP

GTPCH V Pase V

DHNA y Chorismate

pABA

PPPK y

Ptéridine

JIDHPS

7,8-dihydroptéroate D H F S ^ ^

\

PTPS

v SR

BIT

^ D H F R

BH,

DHF I DHFR

THF I FPGS

THF(Glu)n

Figure 1.7. La biosynthèse de novo des ptérines et des folates. (Modifié de (259)).

GTPCH, GTP cyclohydrolase I; PTPS, 6-pyruvoyltétrahydroptérine synthase; SR, sepiapterine reductase; Pase, phosphatase non-spécifique; DHNA, dihydronéoptérine aldolase; PPPK, hydroxyméthyl-dihydroptérine pyrophosphokinase; DHPS, dihydroptéroate synthase, DHFR, dihydrofolate reductase; FPGS, folylpolyglutamate synthase; GTP, guanosine triphosphate; pABA, acide para-aminobenzoïque; BH4, tétrahydrobioptérine; BH2, dihydrobioptérine; DHF, dihydrofolate; THF, tétrahydrofolate, THF(Glu)n, forme polyglutamylée du THF.

32

1.2.1.3 Rôles physiologiques des folates

Le rôle physiologique général des folates est de fournir des unités monocarbonées

nécessaires à un grand nombre de réactions métaboliques connues sous le nom du

métabolisme monocarboné (62, 104, 374). Chaque dérivé du THF est impliqué dans un

nombre limité de réactions qui lui sont propres (Fig. 1.8). Ainsi, le 10-formyl-

tétrahydrofolate (10-CHO-THF) est impliqué dans la synthèse des purines mais également

dans celle du formyl-méthionyl-ARNt dans la mitochondrie (355, 371). Le 5,10-méthylène-

tétrahydrofolate (5,10-CH2-THF) est impliqué dans la conversion de la serine en glycine

par la serine hydroxyméthyltransférase (SHMT) et est aussi essentiel pour la synthèse de la

thymidine (conversion dUMP en dTMP) par la thymidylate synthase (TS) (104). La

réaction catalysée par TS est la seule source de la biosynthèse de novo de la thymidine,

rendant cette dernière indispensable pour la replication et la réparation de l'ADN ainsi que

pour la stabilité du génome (144). Enfin, le 5-méthyl-tétrahydrofolate (5-CH3-THF) fournit

le groupement méthyl nécessaire pour la conversion de ltiomocystéine en methionine par la

methionine synthase (MS) (104). Cette réaction est irréversible et occupe un rôle important

dans le métabolisme monocarboné puisqu'elle est impliquée dans la synthèse de la S-

adénosylméthionine (AdoMet) à partir de la methionine, permettant ainsi d'alimenter les

réactions de transmethylation en groupements méthyl via l'AdoMet (revue dans (45, 214,

215)). Cet aspect du métabolisme monocarboné sera traité plus bas.

33

Histidine

I Formiminoglutamate

I glutamate formiminotransférase

N-Formimino-THF Nucleotides purines

cyclodeamlnase

F

/

Formate + THF

N5-N10-Méthènyl-THF .10 N l u-Formyl-THF

méthylène-THF dehydrogenase

méthènyl-THF cyclohydrolase Iformyl-THF

dehydrogenase

THF + CO2

N5-N10-Méthylène-THF

méthylène-THF reductase (MTHFR)

N5-Méthyl-THF

methionine synthase

s ^ Glycine

' serine hydroxyméthyI-. transferase (SHMT)

>«► Serine

. — d U M P thymidilate synthase *—fedTMP

DHF

l—r Homocysteine Methionine

THF I dihydrofolate reductase

Nucleotides Pyrimidines

NADPH

Figure 1.8. Rôle des folates dans le métabolisme monocarboné. (Tiré de la thèse de doctorat de Dave Richard, Université Laval, 2004).

Les folates jouent un rôle essentiel dans le métabolisme monocarboné. Ils sont impliqués dans la biosynthèse de la thymidine, des purines et la methionine. Ils sont également impliqués, entre autres, dans la conversion de la serine en glycine et dans le catabolisme de l'histidine.

34

1.2.2 Le métabolisme de la S-adénosylmethionine

1.2.2.1 Introduction

La structure de la 5-adénosylméthionine (AdoMet ou SAM) (Fig. 1.9) a été élucidée

pour la première fois par Cantoni en 1951 et depuis, plusieurs études ont montré que

l'AdoMet est impliquée dans plusieurs réactions biologiques importantes telles la

transmethylation, la trans-sulfuration et la synthèse des polyamines (revue dans (103, 197)).

L'AdoMet est utilisée principalement dans les réactions de transmethylation comme

donneur universel des groupements méthyl. Ces réactions sont assurées par de nombreuses

enzymes du groupe des méthyltransférases (58, 340) qui transfèrent des groupements

méthyl de l'AdoMet aux diverses molécules acceptrices tels les acides nucléiques, les

protéines et les phospholipides (103, 197). La 5-adénosylhomocystéine (AdoHcy) formée

au cours de ces réactions de transmethylation est connue comme étant un inhibiteur

compétitif de ces dernières (215). D'autres inhibiteurs des réactions de transmethylation ont

aussi été décrits, parmi eux la sinéfungine (SNF) (Fig. 1.9), un analogue structural de

l'AdoMet et l'AdoHcy (168, 338). Il s'agit d'un antibiotique naturel qui possède des

propriétés antifongiques, antiparasitaires et antivirales (20, 61, 84, 270, 296, 378).

COOH OH OH OH OH OH OH

AdoMet AdoHcy SNF

Figure 1.9. Structure de la .S-adénosylméthionine (AdoMet), de la S-adénosyl-homocystéine (AdoHcy) et de la sinéfungine (SNF).

35

1.2.2.2 Le cycle de la methionine et la biosynthèse de l'AdoMet

La methionine, un acide aminé essentiel, est nécessaire non seulement pour la

synthèse des protéines mais également pour la synthèse de la 5-adénosylméthionine

(AdoMet) (45, 215). L'AdoMet est synthétisée dans le cytosol à partir de la methionine et

de l'ATP par la methionine adénosyltransférase (MAT) (214). Cette étape de biosynthèse

constitue la première réaction du cycle de la methionine (Fig. 1.10, réaction 1). L'utilisation

de l'AdoMet dans les réactions de methylation cellulaire génère de la S-

adénosylhomocystéine (AdoHcy) qui est hydrolysée en homocysteine (Hcy) et en

adenosine par la S-adénosylhomocystéine hydrolase (SAHH) (Fig. 1.10, réaction 3) (383).

Cette série de réactions est appelée transmethylation (45, 215). L'Hcy formée se situe au

carrefour de deux voies métaboliques; la reméthylation et la trans-sulfuration (Fig. 1.10).

La voie de la reméthylation recycle l'Hcy en methionine à l'aide de la methionine synmase

qui utilise le 5-CH3-THF comme donneur du groupement méthyl (Fig. 1.10, réaction 8).

Chez les mammifères, notamment dans le foie et les reins, il existe aussi une deuxième voie

de reméthylation catalysée par la bétaïne-homocystéine méthyltransférase (BHMT) (Fig.

1.10, réaction 9) utilisant la bétaïne comme donneur du groupement méthyl (45, 215). La

voie de methylation constitue la dernière étape du cycle de la methionine (215). Dans la

voie de la trans-sulfuration 1'homocysteine est transformée de façon irréversible en cysteine

pour la production, entre autres, du glutathion (215). Dans le foie, environ 50 % de la

cysteine utilisée dans la synthèse du glutathion provient de la trans-sulfuration (22).

36

5-CHi-THF Diméthy glycine

Betaine

Methionine I ATP

Cycle de la methionine

AdoMet

Synthèse des

polyamines

co. \ & J ^ AdoMet

décarboxylé

Accepteur (e.g. ADN, ARN, protéines, lipides)

>• y-Glutamylcystéine ATP ©.

Glutamate r

Glycine

Glutathion

Figure 1.10. Le métabolisme de la methionine et de la 5-adénosylméthionine. (Modifié de (197)).

1, methionine adénosyltransférase (MAT); 2, réactions de transmethylation; 3, S-adénosylhomocystéine hydrolase (SAHH); 4, cystathionine P-synthase (CBS), 5, y-cystathionase; 6, y-glutamyl-cystéine synthase (yGCS); 7, glutathion synthetase; 8, methionine synthase (MS); 9, bétaïne-homocystéine méthyltransférase (BHMT); 10, S-adénosylméthionine decarboxylase. AdoMet, S-adénosylméthionine; AdoHcy, S-adénosylhomocystéine; Hey, homocysteine; THF, tétrahydrofolate.

1.2.2.3 Rôle physiologique de l'AdoMet

La transmethylation, la trans-sulfuration ainsi que la synthèse des polyamines

constituent les principales fonctions de l'AdoMet dans la cellule (103, 197). En raison des

nombreux accepteurs des groupements méthyl de l'AdoMet les réactions de

transmethylation jouent plusieurs rôles essentiels dans la cellule. Par exemple, la

methylation des acides nucléiques est cruciale dans le contrôle de l'expression des gènes et

37

la stabilité du génome (85, 98). La methylation des protéines est essentielle, entre autres,

pour la transduction de signaux et la prolifération cellulaire (122) tandis que la methylation

des phospholipides permet de maintenir la flexibilité et la perméabilité des membranes

cellulaires (389). Les méthylations sont aussi impliquées, entre autres, dans la synthèse de

metabolites (e.g. creatine, phosphatidylcholine, epinephrine) et dans la detoxification des

xénobiotiques (e.g. thiols, arsenite) (45). L'AdoMet est aussi important dans la trans-

sulfuration étant impliqué via 1'homocysteine dans la synthèse du tripeptide glutathion

(215). Cette molécule est d'une grande importance puisqu'elle est le principal antioxydant

chez l'homme (196). En raison de son rôle dans la synthèse du glutathion, l'AdoMet a été

utilisé en médecine comme médicament pour traiter les maladies chroniques du foie (197).

L'AdoMet est aussi impliquée, comme seul donneur de groupements aminopropyl, dans la

synthèse des polyamines (spermidine, spermine) (103, 197). Les polyamines jouent un rôle

important dans la cellule, notamment dans l'expression des gènes et la prolifération

cellulaire (228).

1.2.3 Pathologies liées à une carence en folates

Une insuffisance en acide folique est l'une des carences vitaminiques les plus

répandues à travers le monde et cause un certain nombre de maladies graves (165). La

manifestation clinique la plus connue d'une carence en folates est l'anémie mégaloblastique

(11). Il est bien connu maintenant qu'une carence en folates est considérée comme facteur

de risque de plusieurs affections telles une anomalie de fermeture du tube neural (AFTN)

chez le fœtus (109), les maladies cardiovasculaires et l'apparition de démence de type

Alzheimer (349, 359). Le cancer figure aussi parmi ces affections, le plus fréquent étant le

cancer colorectal (166). En raison de leur rôle dans la synthèse de l'ADN et dans les

processus de methylation, les folates peuvent interférer avec la carcinogenèse par deux

mécanismes; soit en induisant l'instabilité de l'ADN, notamment par la réduction de la

biosynthèse de la thymidine, ou en modulant la methylation de l'ADN et des histones (85,

200). Une carence en folates peut habituellement être traitée par une alimentation équilibrée

et riche en fruits et légumes. Parfois, des compléments d'acide folique sont nécessaires,

comme chez les femmes enceintes pour aider à prévenir les malformations du tube neural.

Certains pays, comme les États-Unis et le Canada, ont adopté une politique

38

d'enrichissement en acide folique de certains produits alimentaires. L'apport journalier en

folates recommandé par l'Académie Nationale des Sciences Américaine est de 400 pg pour

l'ensemble de la population et de 600 pg pour les femmes enceintes.

1.2.4 Les antifolates

1.2.4.1 Définition

Le tétrahydrofolate (THF) étant un facteur de croissance essentiel pour toutes les

cellules vivantes, plusieurs médicaments ont été développés pour interférer avec son

métabolisme. En effet, les antifolates sont des antimetabolites utilisés pour inhiber les

enzymes impliquées dans le métabolisme des folates et des purines (enzymes folate-

dépendantes). Il s'agit de molécules ayant une structure analogue à celle des folates ou d'un

de ses précurseurs. Ils sont utilisés comme agents anticancéreux, antibactériens et

antiparasitaires, et la majorité d'entre eux ont pour cible la dihydrofolate reductase

(DHFR). Les autres cibles des antifolates incluent la thymidilate synthase (TS), la

dihydroptéroate synthase (DHPS) et les deux enzymes folate-dépendantes de la voie de

biosynthèse des purines, la glycinamide ribonucleotide formyltransferase (GARFT) et

l'aminoimidazolcarboxamide ribonucleotide formyltransferase (AICARFT) (revue dans

(173,219,254)).

1.2.4.2 Contre le cancer

Le methotrexate (MTX) (Fig. 1.6) a été le premier antimetabolite développé pour

inhiber la croissance et la prolifération des cellules malignes. Initialement il a été utilisé en

oncologic pour le traitement de la leucémie lymphoblastique aiguë (LLA), le cancer le plus

fréquent chez l'enfant, où il a démontré sa pleine efficacité (59, 176). Cet antagoniste de

folate est aussi très efficace dans le traitement de l'arthrite rhumatoïde, la psoriasis et la

maladie de Crohn (101, 167, 335). Le MTX exerce son rôle en inhibant la DHFR

empêchant ainsi la synthèse de tétrahydrofolate (THF) à partir du dihydrofolate (DHF) et

menant à une carence en cofacteurs THF. Ces derniers étant importants pour la synthèse de

l'ADN, leur diminution provoque un arrêt de la division cellulaire conduisant ainsi la

cellule vers la mort. Sous sa forme polyglutamate, le MTX inhibe de façon directe la TS et

la GARFT (2). En raison de la toxicité du MTX et l'émergence de la résistance au

39

traitement, des efforts considérables ont été investis pour développer de nouvelles

molécules antifolates plus sélectives ou à plus large spectre d'action (173, 219). Cependant,

en se basant sur la DHFR comme cible thérapeutique, aucun nouvel antifolate n'a montré

une activité supérieure à celle du MTX et la recherche s'est principalement concentrée sur

les inhibiteurs de la TS, de la GARFT et de la AICARFT (173, 219). Le raltitrexed et le

pemetrexed sont des nouvelles molécules antifolates récemment utilisées en clinique

comme agents anti-cancéreux. Le raltitrexed est un inhibiteur sélectif de la thymidilate

synthase (TS) et, contrairement au MTX, il est très efficace dans le traitement du cancer

colorectal (407). Le pemetrexed, quant à lui, est un antifolate multi-cibles et à large spectre

d'activité. Il inhibe très fortement la TS mais aussi la DHFR, la GARFT et la AICARFT

bloquant ainsi la synthèse des pyrimidines et des purines. C'est en 2004 que le pemetrexed

a été autorisé en clinique pour le traitement du mésothéliome pleural en association avec la

cisplatine et dans le traitement en seconde ligne du cancer du poumon non à petites cellules

(255).

1.2.4.3 Contre les infections bactériennes

Les sulfonamides et le triméthoprime (TMP) sont deux types d'antifolates utilisées

depuis plusieurs décennies pour le traitement des infections bactériennes (333). Le TMP

appartient à la famille des diaminopyrimidines, une classe de molécules couramment

employées comme antibiotiques (219). En raison des différences structurales entre la

DHFR procaryote et eucaryote, le TMP est plus spécifique pour la DHFR bactérienne ce

qui diminue grandement les effets secondaires associés à son utilisation (299). Les

sulfonamides sont un groupe de molécules qui inhibent compétitivement la synthèse de

novo des folates au niveau de la DHPS empêchant ainsi la conjugaison de la molécule de

pABA à l'acide ptéroique (Fig. 1.7) (358).

1.2.4.4 Contre les infections parasitaires

Les antifolates sont fréquemment utilisés pour traiter quelques infections

parasitaires en particulier la malaria causée par Plasmodium falciparum. La pyrimethamine

et la sulfadoxine, ciblant respectivement la DHFR et la DHPS, sont utilisées en première

ligne de défense pour traiter la malaria dans les régions où la résistance à la chloroquine est

40

endémique (241). La combinaison proguanil/dapsone est aussi utilisée pour traiter la

malaria et le metabolite du proguanil, le cycloguanil, est un inhibiteur de la DHFR (195).

De plus, le chlorcycloguanil, la forme active de chlorproguanil, s'avère plus puissant que le

cycloguanil avantageant ainsi l'utilisation en clinique la combinaison

chlorproguanil/dapsone à celle de proguanil/dapsone (254). Une nouvelle classe

d'antifolates, les oxyguanils, représentée par le PS-15 et son metabolite WR99210, des

puissants inhibiteurs de la DHFR, est également utilisée comme agents anti-malaria, mais

son utilisation en clinique a suscité moins d'intérêt à cause de l'intolérance gastro­

intestinale (48).

1.2.4.6 Résistance aux antifolates

Le phénomène de résistance aux antifolates pose un sérieux problème quant à leur

utilisation en chimiothérapie. Cette résistance est rencontrée chez tous les types de maladies

traitées avec les antifolates. Les mécanismes de résistance aux antifolates ont été étudiés de

façon extensive et continuent d'être le sujet de plusieurs études (revue dans (12, 121, 262,

370, 418). Les différents mécanismes de résistance aux antifolates rencontrés in vitro et in

vivo sont :

(i) Réduction de l'entrée de l'antifolate suite à l'altération de la fonction de son

transporteur, soit par des mutations ou par une diminution de son expression;

(ii) Surexpression d'un système d'efflux pour expulser l'antifolate vers l'extérieur de la

cellule;

(iii) Surproduction de la cible cellulaire de l'antifolate ou diminution de son affinité pour

celui-ci par des mutations;

(iv) Réduction de l'activité FPGS ou une augmentation de l'activité y-glutamyl

hydrolase (GGH) dégradant ainsi la chaîne de polyglutamate de l'antifolate et, par

conséquent, en diminuant sa rétention intracellulaire.

41

13 Le métabolisme monocarboné chez Leishmania

Le métabolisme monocarboné est vital pour tous les organismes. Les dérivés du

THF sont à la base de ce métabolisme qui regroupe un ensemble de réactions de transfert

d'unités monocarbonées impliquées dans la synthèse des nucleotides (thymidylate,

purines), la synthèse de certains acides aminés (serine, glycine, methionine) et dans la

synthèse de S-adénosylméthionine (AdoMet) (Fig. 1.8 et 1.10). L'étude des mécanismes de

résistance à l'antifolate methotrexate (MTX) chez le parasite Leishmania nous a conduit

vers la caractérisation et une meilleure compréhension des voies métaboliques des ptérines

(e.g. bioptérine) et des folates (Fig. 1.11). Les ptérines et les folates forment la classe des

ptéridines. La coopération entre les sentiers métaboliques de ces deux molécules constitue

une particularité intéressante du métabolisme des ptéridines chez Leishmania (revue dans

(246, 259)). Une variation du métabolisme de la S-adénosylméthionine (AdoMet) est

observée en réponse à la perturbation du métabolisme des folates par le methotrexate (83,

127). Les folates et l'AdoMet sont les principaux donneurs d'unités monocarbonées dans la

cellule et jouent un rôle crucial dans la biologie du parasite (259, 310). Cette section traitera

du métabolisme des ptérines, des folates et de l'AdoMet chez Leishmania. Nous aborderons

le transport de ses trois molécules chez Leishmania ultérieurement.

1.3.1 Le métabolisme des ptérines

Contrairement aux mammifères, le parasite Leishmania ne possède pas les enzymes

nécessaires à la biosynthèse de novo de la tétrahydrobioptérine (BH4) (246, 259). La

bioptérine a été décrite initialement comme étant un facteur de croissance chez le parasite

Crithidia fasciculata (158, 162). Plusieures études ont par la suite montré que la bioptérine

ainsi que d'autres ptérines sont aussi essentielles pour la croissance de plusieurs espèces de

Leishmania (28, 159, 274, 279, 322, 343, 377). Deux enzymes jouent un rôle clé dans le

métabolisme des ptérines chez Leishmania; le transporteur de la bioptérine (BT1) (voir

section 1.6) et la ptéridine reductase (PTR1) (Fig. 1.11).

-Cv s c

f a CJ « c o £

II « s '<a S S o • «

S 2

2 â <u <u S N M) »

•— £ Um U

"2 i i c U N

es C X CJ S "

C

s-

u c ÙO o

M C M

e » y. .S c T3 = c

■U co CO

3 CU

co y W o

"S "g o -£ ~ es cj G c o CO

S o-

3 13

C ■ • —

Q . C O

co W 'CU

es c U

'CJ

o c co 3 CS

CJ

-J E

u

o -o

ccî

I 5

-s: .CO

3 eu

c ■—

es CJ O S O T J

•** f l 3

fi JB «"S - S '«J *S

l -3 C

. s 2 o o S -S "°

03

E co

— U 85 -8.1.3

U ~ TJ

3 CJ S

-O 1. ~ r. r, a

. . es ' C J + 1

C u

3 > S 5

— co «J

3 "g i i O" S c

' « O 3 < " CJ [ i ,

-cj -C B.H Ç J CJ

C D. co

Q. S O es

15 P X

es F-— u.

or; fi » fe - 3 5 T J CJ

Q ' | f c - = — ■

— C/3

8 of « S X T J

t - _5 as = ^ T J es •CJ

U 3

O eu —

-

♦3 P

CJ T3 U

3 — CJ . O t ^~ o CJ O . T J S Sa es D

fi n o

~- & H èî CQ J3

_: u

T ) >> es

- u CJ

E 1 E g *

T | - 2 C2 J3 O 2

CJ

— «

2 E T3

^ x

CJ —

: « £c° b-H P co eu "3 «s

•fi 6. i/-> "O éo

g fi . 3 '*>

'S w A co

•ÇJ S E

es co S es

"O " 3 (50 O O

< CJ ç j . es O

È -s u _ i . 3 ^ >> 3 " co O co

3 O g '«> E

CJ CJ

3 4 >> 2 ■ 60 T J es - =

J CJ E CJ CL cj

o iS

3 co

H S ^ - É

"° fc. >>-5 tL" co

'CJ TJ

_ f 2 fe E

eu C/3 -O

es CJ cj

x CJ w 3 CJ

3 — -CJ H p ">L

s * p C/3 CJ C

t u eu ; »

JJ-8 tS t2 "C e** c4-c j a

P P 12 — — —

T J TJ P > . > > . 3

JS -C O es es p fi fi .13 'CJ 'CJ 3

CJ > ç

.2P eu co

s 2 c2 "

CJ T3

CJ eu S es -» > to

> i CJ G E c

O es

CJ 3 :

§•*& « P es S B 'CJ C -o

es ce

. „ esOTD

I ac = g « 5 E e u P '-eu ; r â S £ p ^

1 &

- C ^ > I—

CJ

CJ X

C u f e

p s CJ C/3

CJ X O

■ o

<

co Ë

« fe" .E S ' C J t — ■55 TJ CJ

_

G

S -J3

-CJ E

42

43

1.3.1.1 Le transport et la réduction des ptérines

L'entrée de la bioptérine dans la cellule se fait par l'intermédiaire d'un transporteur

spécifique nommé BT1 (179, 188) (Fig. 1.11). Une fois à l'intérieur du parasite, la

bioptérine sous forme oxydée est successivement réduite en dihydrobioptérine (BH2) puis

en tétrahydrobioptérine (BH4) par la ptéridine reductase (PTR1) (Fig. 1.11) (199, 245).

Cette protéine appartient à une famille de déshydrogénases reductases à courte chaîne, elle

est NADPH-dépendante et active sous forme tétramérique (245, 398). Chez les parasites

promastigotes, l'enzyme PTR1 est différentiellement exprimée au cours des phases de

croissance et son activité est plus élevée au stade promastigote par rapport au stade

amastigote (73). Une des particularités intéressantes de cette enzyme chez Leishmania est

qu'elle possède une activité dihydrofolate reductase catalysant la réduction de l'acide

folique et la dihydrofolate (DHF) en tétrahydrofolate (THF) (Fig. 1.11) (245). Les mutants

PTRl' ' sont incapables de croître sans l'ajout de la bioptérine sous forme réduite, mais non

des folates, dans le milieu de culture démontrant l'importance de la réduction des ptérines

dans la biologie du parasite (30, 245). De plus, F inactivation de PTRl dans plusieurs

espèces de Leishmania conduit à une hypersensibilité au MTX (30, 180, 274) et a une

hypervirulence des parasites (74).

Des homologues de PTRl de Leishmania ont été identifiés et caractérisés chez

d'autres Trypanosomatidae comme Trypanosoma brucei (76, 351, 354) et Trypanosoma

cruzi (314, 339) et également chez certaines bactéries (77, 111, 248). Contrairement aux

PTRl des trypanosomatides qui possèdent la capacité de réduire les formes oxidées des

ptérines (76, 314, 354), les hydrolases identifiées chez les bactéries (e.g. E. coli, Xylella

fastidiosa) n'ont pas d'activité sur ces formes (77, 111, 248).

1.3.1.2 Autres enzymes du métabolisme des ptérines

Deux enzymes de la voie des ptérines ont été identifiées dans le génome de

Leishmania; la quinonoide dihydroptéridine reductase (QDPR) et la ptérine 4a-

carbinolamine dehydratase (www.genedb.org). Chez les mammifères, ces enzymes sont

impliquées dans la régénération des pools de tétrahydrobioptérine (BH4) (373). Il a été

démontré que la QDPR de Leishmania possède la capacité de régénérer la BH4 à partir de la

44

dihydrobioptérine quinonoi'de (qBH2) (202) tandis que la fonction de la ptérine 4a-

carbinolamine dehydratase reste à déterminer. PTRl, quant à elle, n'a aucune activité

envers la qBH2 (398).

1.3.1.3 Rôle physiologique de la bioptérine chez Leishmania

L'importance de la tétrahydrobioptérine (BH4) comme facteur de croissance a été

démontrée à plusieurs reprises chez Leishmania. Par exemple, il a été observé que des

souches de Leishmania fraîchement isolées de lésions pouvaient croître beaucoup plus

rapidement avec un apport de bioptérine dans le milieu de culture, jusqu'à un certain

nombre de passages où l'ajout de la bioptérine n'était plus d'aucun avantage pour la

replication (322). Au cours de la culture, ces parasites s'adaptent en surexprimant le

transporteur BT1 ou PTRl afin de leur permettre d'utiliser plus efficacement la bioptérine

(322). De plus, le locus Leishmania DNA 1 (LDI), sur lequel se retrouve le gène BT1, est

fréquemment amplifié chez plusieurs souches de Leishmania (345, 379) et la deletion du

gène BT1 par recombinaison homologue réduit fortement la croissance des parasites (179,

272). Ces résultats démontrent l'avantage que procure le transport de la bioptérine pour la

croissance du parasite.

La BH4 joue aussi un rôle déterminant dans la différenciation du parasite de la phase

promastigote non-infectieuse au stade promastigote métacyclique (Fig. 1.7), processus

appelé la métacyclogénèse (74). En effet, il a été démontré, à l'aide d'un mutant PTRÏ ',

que de bas niveaux de BH4 étaient nécessaires pour augmenter la métacyclogénèse, ce qui

conduisait aussi à de l'hypervirulence (74, 230). Cependant, le mécanisme par lequel la

diminution du niveau de BH4 augmente la métacyclogénèse est inconnu. Une des

hypothèses est que BH4 agirait comme signal contrôlant la differentiation (74), comme

c'est le cas chez d'autres organismes, tel Dictyostélium, où les ptérines sont impliquées

dans le processus de signalisation menant au développement multicellulaire (129, 330). Il

serait aussi possible que BH4 joue un rôle de cofacteur pour des enzymes, non identifiées

jusqu'à maintenant, impliquées dans le processus de differentiation (74).

Par ailleurs, on ne connait pas le rôle exact des ptérines dans le métabolisme de

Leishmania. Chez les mammifères, la BH4 est un cofacteur des enzymes impliquées dans

45

l'hydroxylation des acides aminés aromatiques, de la glycéryl-éther monooxygénase, une

enzyme impliquée dans le catabolisme des lipides et de l'oxyde nitrique synthase (NOS)

(revue dans (194, 373)). Chez Leishmania, la présence des activités enzymatiques

catalysant la synthèse de l'oxyde nitrique et le clivage éther-lipide a été démontrée (25,

110, 204). Cependant, aucune oxyde nitrique synthase (NOS) n'a été identifiée dans le

génome de Leishmania (www.genedb.org) et l'activité de clivage éther-lipide est NADPH-

dépendante (204). Par contre, Leishmania possède une phénylananine hydroxylase (PAH),

mais la génération de souches déficientes en PAH n'a. mené à aucune différence par rapport

à la souche sauvage en termes de croissance, de differentiation ou de virulence (203). La

BH4 joue aussi un rôle dans la défense contre le stress oxidatif et nitrosatif chez les

mammifères (172, 227). Des études récentes ont aussi suggéré le même rôle chez

Leishmania (230, 244). Cependant, le mécanisme impliqué dans cette résistance n'est pas

encore clair.

1.3.1.3.1 Rôle des ptérines dans la synthèse des folates chez Leishmania

Leishmania est auxotrophe pour les folates et doit obligatoirement les importer du

milieu externe (159, 279, 343, 377). Par contre, certaines espèces de Leishmania ont la

capacité de croître dans un milieu dépourvu de folates, mais complété par l'ajout de

ptérines (28, 274, 279). Cette observation a été faite chez L. donovani qui serait capable de

métaboliser la bioptérine en dérivés tétrahydrofolates (27). Une étape importante dans la

biosynthèse du THF est la conjugaison du noyau du ptérine avec la molécule d'acide para-

aminobenzoïque (pABA) par la dihydroptéroate synthase (DHPS) (Fig. 1.7). Or, il a été

démontré que L. major ne peut pas métaboliser le pABA en folates (175) et que L. major

ainsi que L. donovani sont insensibles aux sulfonamides, les inhibiteurs de la DHPS (159,

279). Ceci fournit un argument mettant en doute que L. donovani ait la capacité de

synthétiser ses propres folates à partir de la bioptérine. Par contre, si les ptérines jouent un

rôle dans la synthèse des folates, la voie métabolique impliquée dans ce processus, jusqu'à

présent inconnue, est peut-être différente de la voie classique. De toute façon, le besoin en

folates chez le parasite Leishmania est assuré principalement par l'import de ces molécules

à partir du milieu extérieur via des transporteurs spécifiques.

46

1.3.2 Le métabolisme des folates

Aucun des gènes codant pour des enzymes de la voie de biosynthèse des folates n'a

été identifié dans le génome de Leishmania (www.genedb.org) suggérant que ce parasite

est auxotrophe pour les folates. Par contre, une famille de gènes codant pour plusieurs

transporteurs a été identifiée dont deux membres, FT1 et FT5, jouent un rôle important

dans le transport de l'acide folique et de l'antifolate methotrexate chez ce parasite (311,

312). Le séquençage du génome de Leishmania a permis de caractériser certaines enzymes

du métabolisme monocarboné utilisant les folates comme la serine

hydroxyméthyltransférase (SHMT) (106), la méthyiène-tétrahydro folate reductase

(MTHFR) (394), l'enzyme bifonctionnelle méthylènetétrahydrofolate

déshydrogénase/méthényltétrahydrofolate cyclohydrolase (DHCH) (240), la formyl-

tétrahydrofolate ligase (FTL) (393) ainsi que le complexe enzymatique du clivage de la

glycine (CGC) (237, 344). Ces études ont apporté des nouvelles informations sur le rôle des

folates dans le métabolisme cellulaire du parasite ainsi que les premières preuves d'une

compartimentation du métabolisme monocarboné entre le cytoplasme et la mitochondrie

(Fig. 1.11).

1.3.2.1 La réduction et la polyglutamylation des folates

Leishmania possède la capacité de réduire l'acide folique en DHF et ce dernier en sa

forme active, le THF. Cette activité est assurée par la dihydrofolate reductase (DHFR), une

enzyme qui a la particularité, chez Leishmania, d'être associée à la thymidilate synthase

(TS) formant une enzyme bifonctionnelle DHFR-TS. L'activité TS, quant à elle, est

responsable de la synthèse de la thymidine (34, 126). Concernant la nature bifonctionnelle

de l'enzyme, plusieurs études ont mis en lumière un phénomène d'enchaînement du

substrat où le produit de la réaction de DHFR est transféré directement de son site actif à

celui de la TS sans qu'il ne soit relâché dans le milieu environnant (14, 170, 191, 225).

Contrairement aux DHFRs des mammifères qui possèdent une activité reductase envers la

BH2, la DHFR-TS de Leishmania est dépourvue de cette activité (245). Des mutants nuls

du gène DHFR-TS deviennent auxotrophes pour la thymidine confirmant le rôle essentiel

de cette enzyme dans la synthèse de la thymidine (70, 71). Bien qu'il est relativement

simple de générer des mutants DHFR-TS' ' chez des souches de L. major de laboratoire, il

47

semble en être autrement chez les souches très virulentes (72). Cela suggère qu'en plus de

jouer un rôle dans la biosynthèse de la thymidine, la DHFR-TS semble être nécessaire à la

virulence des parasites (72). En effet, il a été démontré que des souches DHFR-TS' ' sont

incapables de soutenir une infection de macrophages en culture ou chez des souris

normalement sensibles au Leishmania (375).

À l'intérieur des cellules de mammifère, les folates et l'antifolate methotrexate sont

polyglutamylés grâce à l'enzyme folylpolyglutamate synthetase (FPGS) (229, 350).

L'activité folylpolyglutamate a été décrite pour la première fois chez L. major où il a été

découvert que la majorité des folates se trouvaient sous une forme tétraglutamylée et

pentaglutamylée tandis que le methotrexate (MTX) était très faiblement polyglutamylé (96,

334). L'enzyme responsable de la polyglutamylation des folates, la folylpolyglutamate

synthetase (FPGS), a été clonée et caractérisée chez L. tarantolae (91). La FPGS de L.

tarentolae est une protéine de 538 acides aminés ayant une homologie de séquence avec les

FPGS humaine et de la levure (respectivement 33% et 30% d'identité). Contrairement à L.

major, le MTX est retrouvé sous une forme polyglutamylée chez L. tarentolae (89, 96).

Cette différence pourrait être expliquée par la présence d'une plus forte activité MTX

alpha-hydrolase facilement mesurable chez L. major mais non chez L. tarentolae (89, 96).

Cette activité a aussi été observée chez d'autres parasites comme L. donovani (159) et

Crithidia fasciculata (256). L'incapacité de générer une souche déficiente en FPGS suggère

que cette enzyme est essentielle à la survie du parasite Leishmania (91).

1.3.2.2 Rôle physiologique des folates chez Leishmania

Le rôle connu des dérivés du THF chez Leishmania est la synthèse de la thymidine

(70, 71). La présence d'une activité serine hydroxyméthyltransférase (SHMT) responsable

de la conversion de la serine en glycine a été détectée chez plusieurs espèces de Leishmania

(250) et a été confirmée chez L. donovani par la purification et la caractérisation

biochimique de cette enzyme (391). La présence de deux isoformes de SHMT chez L.

major, une cytosolique et l'autre mitochondriale, a été récemment démontrée (106). La

localisation de ces deux isoformes de SHMT fournit la première évidence de la

compartimentation du métabolisme monocarboné chez Leishmania (106). De plus, le

parasite Leishmania est capable de synthétiser le dérivé 5,10-CH2-THF dans la

48

mitochondrie par le complexe enzymatique du clivage de la glycine (CGC) (344). Ces

résultats suggèrent un rôle des folates dans le métabolisme de la mitochondrie.

Lorsque les cellules de Leishmania sont incubées avec de l'acide folique marqué au

tritium, ce dernier est métabolisé principalement en 5-méthyltétrahydrofolate (5-CH3-THF)

et en 10-formyltétrahydrofolate (10-CHO-THF) (27, 343, 394). Le rôle connu du 5-CH3-

THF est la reméthylation de l'homocystéine en methionine, tandis que le 10-CHO-THF est

impliqué dans la synthèse des purines et la formylation de la méthionyl-ARNt (62). Le

génome de Leishmania code pour une méthylèneTHF reductase (MTHFR), l'enzyme qui

génère le 5-CH3-THF (Fig. 1.8), et deux methionines synthases. Bien que la methionine

synthase ne soit pas encore étudiée, l'étude biochimique et fonctionnelle de la MTHFR

chez L. major a montré que la voie de la reméthylation de l'homocystéine en methionine

est fonctionnelle chez ce parasite (394).

Le rôle du 10-CHO-THF dans le métabolisme de Leishmania n'est pas encore clair

mais ce metabolite est essentiel pour la survie du parasite (240). Leishmania est auxotrophe

pour les purines (51), ce qui suggère que le seul rôle que peut avoir le 10-CHO-THF chez

le parasite est la formylation de la méthionyl-ARNt dans la mitochondrie (240) (Fig. 1.11).

La formylation de la méthionyl-ARNt n'est pas encore étudiée chez Leishmania, mais elle

semble être essentielle pour la biosynthèse des protéines chez le parasite trypanosomatide

T. brucei (56). Des études antérieures ont rapporté que la formylation de la méthionyl-

ARNt chez T. brucei se fait dans la matrice mitochondriale et qu'une méthionyl-tRNA

formyl-transferase (MFT) serait responsable de cette activité (372). Le génome de

Leishmania code pour un analogue de MFT, mais des études sont nécessaires pour

determiner si cette enzyme est fonctionnelle chez Leishmania (Fig. 1.11). Le fait que le 10-

CHO-THF est synthétisé exclusivement dans le cytoplasme chez L. major suggère que ce

cofacteur doit être transporté par la mitochondrie pour la formylation de la méthionyl-

ARNt (240, 393). Chez les mammifères le 10-CHO-THF est transporté à l'intérieur de la

mitochondrie par une protéine de la famille des transporteurs membranaires

mitochondriaux (MCF) (217, 280, 376) et des homologues de ce transporteur ont été

identifiés chez les trypanosomatides (67).

49

1.3.3 Le métabolisme de la 5-adénosyIméthionine

L'AdoMet est le donneur principal des groupements méthyl dans toutes les

réactions de methylation cellulaire exceptée la methylation de l'homocystéine en

methionine (Fig. 1.10, réactions 8 et 9). Le génome de Leishmania code pour les enzymes

du métabolisme de l'AdoMet dont la methionine adénosyltransférase (MAT) qui a été bien

étudiée chez ce parasite (Fig. 1.11) (revue dans (251, 310)). Mentionnons que la

sinéfungine (Fig. 1.9), un inhibiteur des réactions de transmethylation, a montré une très

forte activité anti-Leishmania in vitro et in vivo, d'où l'intérêt grandissant pour l'étude du

métabolisme de l'AdoMet dans la course aux nouvelles cibles thérapeutiques (310, 396).

1.3.3.1 La biosynthèse de l'AdoMet par MAT2

La methionine adénosyltransférase (MAT) (Fig. 1.10, réaction 1) catalyse la

formation de l'AdoMet à partir de l'ATP et de la methionine. Chez Leishmania, cette

protéine de 394 acides aminés est codée par deux gènes identiques (gène MAT2) situés en

tandem, et elle partage une forte homologie de séquence (entre 52% et 60% de similarité)

avec les MATs des autres organismes (e.g. S. cerevisiae, E. coli, Homo sapiens, P.

falciparum) (309). MAT2 est active sous forme de dimère et son activité est insensible à

une inhibition allostérique par l'AdoMet (309). Des études de mutageneses dirigées ont

permis d'identifier les acides aminés impliqués dans l'hydrolyse de l'ATP, dans

l'interaction avec les métaux (e.g. Mg2*) et dans le site actif de l'enzyme (281, 283).

L'expression de la protéine MAT2 ainsi que son activité sont régulées lors des différentes

phases de croissance chez les promastigotes, étant plus élevées en phase logarithmique et

quasi-indétectables en phase stationnaire de croissance (282). Par contre, le niveau de

l'ARNm de MAT2 ne change pas lors des différentes phases de croissance, ce qui suggère

que la régulation du gène MAT2 se fait au niveau post-traductionnel (282). La

surexpression du gène MAT2 chez Leishmania conduit à l'efflux de l'AdoMet et à la

résistance à la sinéfungine (282). Par ailleurs, un changement au niveau du métabolisme de

l'AdoMet a été observé chez des souches de Leishmania sélectionnées pour la résistance à

l'antifolate methotrexate (MTX) (83, 127). En effet, l'expression de MAT2 augmente chez

ces mutants (83, 127) et la surexpression du gène MAT2 chez une souche sensible au MTX

50

facilite l'acquisition de la résistance à cet antifolate (83). Ces résultats démontrent

l'implication, quoiqu'indirecte, de MAT dans la résistance au methotrexate.

1.3.3.2 Rôle de l'AdoMet chez Leishmania

Il est connu depuis longtemps que l'AdoMet joue un rôle dans les réactions de

methylation cellulaire chez Leishmania (17, 187, 269), mais aucune méthyltransférase

spécifique n'a encore été caractérisée à l'échelle moléculaire (310). Récemment, une

guanine-N7 méthyltransférase, une enzyme qui catalyse la methylation AdoMet-

dépendante de la coiffe des ARNm a été identifiée et caractérisée chez le parasite T. brucei

et un homologue de cette protéine est codé par le génome de Leishmania (132).

Chez les mammifères, l'AdoMet sert également de précurseur pour la synthèse de la

cysteine et du glutathion (Fig. 1.10, réactions 4-7). La présence d'une voie de trans-

sulfuration inverse (Fig. 1.10, réaction 4, 5) active a surtout été démontrée chez les

trypanosomes, notamment chez T. brucei (19, 115, 252, 413). Le génome de Leishmania

code pour les deux enzymes de la voie de trans-sulfuration inverse (Fig. 1.10, réaction 4, 5)

et la caractérisation biochimique de l'une d'entre elles, la cystathionine p-synthase (CBS),

suggère que cette voie est fonctionnelle chez Leishmania (406). Une étude récente a

démontré que la y-glutamyl-cystéine synthase (yGCS) (Fig. 1.10, réaction 6), une enzyme

catalysant la première étape dans la biosynthèse du glutathion, est essentielle chez

Leishmania (234) ce qui démontre l'importance de cette molécule dans la biologie du

parasite. De plus, les trypanosomatides synthétisent un antioxydant très puissant, le

trypanothione (264). Ce conjugué glutathion-spermidine joue un rôle central dans le

maintien d'un environnement réducteur intracellulaire et dans les défenses anti-oxydatives

des parasites (238).

L'AdoMet sous sa forme décarboxylée (Fig. 1.10, réaction 10) joue un rôle

important dans le métabolisme des polyamines, notamment dans la biosynthèse de la

spermidine. La S-adénosylméthionine decarboxylase (Fig. 1.10, réaction 10), l'enzyme qui

génère les formes décarboxylées de l'AdoMet est largement étudiée chez les trypanosomes

et a été exploitée comme cible thérapeutique chez ces parasites (251, 396). Le gène de la S-

adénosylméthionine decarboxylase est présent dans le génome de Leishmania et une étude

51

a montré que des mutants nuls de ce gène deviennent auxotrophes pour la spermidine

confirmant le rôle de cette enzyme dans la synthèse des polyamines (315).

1.4 Les antifolates et Leishmania

Les folates sont essentiels pour la croissance et la survie de Leishmania. Cela

suggère que l'inhibition de certaines voies métaboliques vitales pour le parasite pourrait

constituer une excellente cible thérapeutique pour lutter contre la leishmaniose. Malgré leur

efficacité dans le traitement des infections bactériennes et parasitaires, les antifolates se

révèlent inefficaces contre les leishmanies. L'inefficacité de certains composés comme la

pyrimethamine et le trimethoprim résulte de leur faible affinité pour l'enzyme

bifonctionnelle DHFR-TS de Leishmania. Toutefois, le methotrexate, un analogue de

l'acide folique (Fig. 1.6), a démontré une très bonne affinité pour cette enzyme, mais inhibe

également très fortement la DHFR humaine et rend donc son utilisation comme agent anti-

Leishmania impossible (341). Par contre, l'étude des mécanismes de résistance au

methotrexate rencontrés chez le parasite a permis d'identifier plusieurs particularités du

métabolisme des ptéridines qui pourraient être exploitées dans le but de concevoir de

nouvelles stratégies pour combattre la leishmaniose.

1.4.1 Les mécanismes de résistance au methotrexate chez Leishmania

La génération des souches de Leishmania résistantes au methotrexate, en plus de

permettre d'identifier et d'étudier le métabolisme des ptérines, des folates et de la S-

adénosylméthionine, a conduit également à 1'elucidation des principaux mécanismes de

défense cellulaire permettant au parasite de survivre en présence du methotrexate. Les

principaux mécanismes de résistance au MTX rencontrés in vitro chez Leishmania sont (i)

une diminution de l'entrée de l'inhibiteur, (ii) une amplification génique de la DHFR-TS,

(iii) une amplification du gène de PTRl et (iv) une modification de la polyglutamylation

du MTX.

52

1.4.1.1 Diminution de l'entrée du MTX

Un moyen très efficace permettant au parasite Leishmania de résister aux effets

toxiques du MTX est de diminuer son entrée dans la cellule. Étant donné que le MTX et

l'acide folique partage le même système de transport, la réduction du transport de ces deux

molécules se fait de façon concomitante (95, 159, 275). Deux types de défauts dans le

système de transport folate/MTX ont été répertoriés chez les mutants hautement résistants

au MTX, une diminution partielle d'environ cinq fois le niveau de la souche sauvage et une

abrogation presque complète de l'influx (275). Leishmania est auxotrophe pour les folates

et dépend principalement du transport de ces molécules du milieu externe pour sa survie.

Or, les souches résistantes ayant un système de transport folate/MTX profondément altéré

doivent compenser pour cette perte. Chez L. tarantolae, tous les mutants ayant une

diminution presque complète de l'accumulation du MTX avaient en plus une surexpression

du transporteur de la bioptérine BT1. Cette surexpression n'est pas due à une amplification

du gène BT1 mais à un réarrangement génique impliquant celui-ci (179). La caractérisation

du transporteur BT1 a démontré qu'il peut transporter avec une faible capacité les folates

mais pas le methotrexate. La surexpression de BT1 permet donc d'avoir un apport suffisant

en folates pour assurer la survie du parasite lorsque le système privilégié de transport des

folates est inactif (179).

Par ailleurs, il est possible qu'une amplification du gène BT1 soit observée chez

d'autres espèces de Leishmania, chez qui l'entrée des folates est diminuée. Par exemple,

l'amplification du locus LDI, contenant le gène BT1, a été détectée chez des souches de L.

major résistantes au MTX et est bel et bien utilisée par le parasite pour survivre à la

présence du MTX (32). Toutefois, la surexpression de BT1 demeure surtout une réponse

secondaire à la suppression du transporteur primaire des folates.

BTI fait partie d'une famille multigénique dont certains membres sont délétés chez

des mutants hautement résistants au MTX et chez qui l'entrée des folates est abrogée (311,

312, 384). Deux de ces membres nommés FT5 et FT1 correspondent a des transporteurs de

folates et du MTX (311, 312). Les mutants où FT5 a été complètement inactivé par

recombinaison homologue sont encore capables de transporter des folates, et la transfection

de FT5 chez ces mutants renverse partiellement la résistance au MTX (311). Ces résultats

53

suggèrent qu'un autre transporteur de la famille multigénique pourrait aussi être impliqué

dans la résistance au MTX. En effet, des mutants de L. infantum amputés du gène FT1

présentent une diminution d'environ 75 % du transport des folates et du MTX (312)

confirmant ainsi son implication dans ce mécanisme de résistance. De plus, la

surexpression de FT1 chez des mutants de L. tarentolae hautement résistants au MTX

restaure le transport de l'antifolate au même niveau que la souche sauvage (312).

1.4.1.2 Amplification génique de la DHFR-TS

L'amplification génique chez Leishmania est un mécanisme fréquemment utilisé en

réponse aux stress extérieurs (31, 108, 125, 261). L'amplification du gène DHFR-TS est le

premier exemple d'amplification génique étudié chez un parasite protozoaire et a été

observé chez une souche de L. tropica résistante au MTX (65). Par la suite, ce phénomène a

été retrouvé chez d'autres espèces de Leishmania sélectionnées pour la résistance au MTX

(31, 34, 95, 384, 400). Une amplification du gène de la DHFR-TS est fréquemment

observée chez des mutants sélectionnés de L. major. Par contre, chez d'autres espèces

comme L. tarentolae, il n'est possible d'observer une telle amplification seulement lorsque

le gène de la ptéridine reductase (PTRl) a été préalablement inactivé (92, 180). Ceci

pourrait s'expliquer par le fait que PTRl confère un plus haut niveau de résistance au MTX

et que le locus sur lequel il se trouve est plus facile à amplifier par le parasite (180).

Les cas de résistance aux antifolates due à des mutations dans le gène de la DHFR-

TS sont très fréquents chez Plasmodium falciparum, l'agent étiologique de la malaria

(254). Par contre, ce mécanisme de résistance n'a été décrit qu'une fois chez Leishmania

(9).

1.4.1.3 Amplification génique de PTRl

Le gène de PTRl est situé dans une région du génome nommée le locus H. Ce

dernier est souvent amplifié chez des mutants résistants à divers inhibiteurs tels les

oxyanions (5, 46, 123, 273), l'antimoine (131), l'arsenite (258), la primaquine (94) et le

MTX (33, 124, 142, 275, 276, 287).

54

La fonction principale de PTRl est la réduction de la bioptérine et de la

dihydrobioptérine (BH2) en tétrahydrobioptérine (BH4), mais elle peut en plus, dans une

moindre mesure, réduire l'acide folique en tétrahydrofolate (THF) (245, 398). La

surexpression de PTRl en présence du MTX confère des niveaux de résistance

considérables chez le parasite (47, 276). Le MTX est un puissant inhibiteur de la DHFR et

cette activité est attribuée principalement aux fortes interactions entre le site actif de

l'enzyme et le groupement p ABA de l'antifolate (149). Par contre, ce groupement n'a que

très peu d'affinité avec le site actif de la PTRl, ce qui explique pourquoi la surexpression

de celle-ci peut outrepasser l'inhibition de DHFR-TS et assurer la survie des parasites en

fournissant à la cellule des quantités suffisantes de folates réduits (149, 246). Ce

mécanisme de compensation suggère qu'une stratégie thérapeutique basée sur la

suppression de la régénération du THF doit nécessairement combiner l'inhibition de

DHFR-TS et de PTRl.

1.4.1.4 Altération de la polyglutamylation du MTX

Il a été démontré chez différents mutants résistants au MTX et ayant une réduction

partielle ou presque complète de l'accumulation de folate/MTX que les formes

monoglutamylées du MTX sont majoritaires dans ces mutants alors que l'acide folique est

polyglutamylé. Cette différence n'est pas due à une diminution de l'activité FPGS face au

MTX. Par contre, il est possible qu'une activité MTX-hydrolase (e.g. alpha-hydrolase,

gama-glutamyl hydrolase) pourrait être responsable de la diminution de la chaine

polyglutamate du MTX (89). Il a aussi été observé que la concentration extracellulaire en

folates pouvait influencer le comportement du parasite envers le MTX. En effet, la

surexpression de FPGS conduit à une résistance au MTX dans un milieu riche en folates et

à une susceptibilité dans un milieu pauvre en folates comparativement à la souche sauvage

(89).

55

1.5 Transport des donneurs d'unités monocarbonées (folate, AdoMet)

Les folates et l'AdoMet sont des molécules polaires et sont incapables de traverser

la bicouche lipidique par diffusion passive. Leur passage à travers la membrane nécessite

donc des protéines de transport membranaire. Dans cette section nous allons aborder les

différents systèmes de transport des folates et de l'AdoMet présents chez différents

organismes. Le transport des ptéridines (bioptérine et folate) et d'AdoMet chez Leishmania

sera abordé dans la section 1.6.

1.5.1 Chez les bactéries

Chez les bactéries, deux systèmes de transport de folates ont été caractérisés; le

transporteur slr0642 de la famille FBT et le transporteur FolT de la classe des transporteurs

ECF (Energy-Coupling Factor), par contre le transport de l'AdoMet est assuré par un

membre de la superfamille des transporteurs de metabolites.

1.5.1.1 Le transporteur slr0642 de la famille FBT

Le premier système permettant l'influx des folates chez les bactéries a été isolé et

caractérisé chez la cyanobactérie Synechocystis (169), un organisme qui a en plus la faculté

de synthétiser les folates (77). Ce transport est assuré par la protéine slr0642, un membre de

la famille des transporteurs de folate et de la bioptérine (FBT) caractérisée à l'origine chez

le parasite Leishmania (169). Les expériences de complémentation réalisées avec slr0642

sur des mutants E. coli auxotrophes pour les folates et incapables d'en effectuer le

transport, ont montré que la protéine slr0642 transporte le folate monoglutamylé ainsi que

le methotrexate, mais pas le folate triglutamylé et le pABA-Glu (169). Chez E. coli, le

transport de/?ABA-Glu est effectué par un système de faible affinité codé par le gène AbgT

(50, 150). La caractérisation du transporteur AbgT est à l'origine de la famille de

transporteur pAB A-Glu, classée dans la superfamille de transporteur d'ions (293).

Le transporteur slr0642 ainsi que les autres membres de la famille FBT font partie

de la superfamille des facilitateurs majeurs (MFS pour Major Facilitator Superfamily) (55)

caractérisée par la présence de 12 domaines transmembranaires avec les parties N- et C-

56

terminales dirigées vers le cytoplasme (185). Des transporteurs de la MFS avec seulement

6, 14 ou 24 domaines transmembranaires ont été aussi identifiés (185). Cette superfamille

de protéines membranaires est retrouvée des bactéries jusqu'aux eucaryotes supérieurs où

elles assurent le symport, l'antiport et l'uniport de divers substrats, tels des sucres, des

metabolites intermédiaires et des antibiotiques (328). L'analyse de séquence de la protéine

slr0642 a indiqué la présence de 12 domaines transmembranaires avec une localisation

cytoplasmique des extrémités N- et C-terminales (Fig. 1.12). L'utilisation de la mutagénèse

dirigée et la construction d'un modèle structural de slr0642 en se basant sur la structure

cristallographique de LacY d'E.coli ont apportées des données précieuses sur la relation

structure-fonction du transporteur (100). En particulier, l'étude des acides aminés conservés

dans l'ensemble des transporteurs de la famille FBT a permis de montrer leur importance

pour l'activité de transport (100). Ce même travail met en évidence les résidus qui sont

critiques pour l'activité de transport et dont la majorité se concentre au niveau des

domaines transmembranaires 1, 4, 7 et 10, formant la base de la cavité centrale telle que

prédite dans le modèle structural de slr0642 (100).

H1 H2 H3 H4 H5 H6 H7 H8 H9 H10 H11 H12

Figure 1.12. Représentation de la structure secondaire du slr0642. (Tiré de (169)).

Le slr0642 est une protéine formée de deux groupes de 6 hélices transmembranaires reliés par une petite boucle cytoplasmique entre les hélices 6 et 7. Les deux extrémités N- et C-terminales sont du côté cytoplasmique.

57

1.5.1.2 Le transporteur FolT de la classe des transporteurs ECF

Certains lactobacilles comme Lactobacillus casei et Lactobacillus salivarius sont

auxotrophes pour les folates et requièrent une source de folates exogène pour leur

croissance. L'existence d'un système permettant l'influx des folates chez ces bactéries est

connu depuis maintenant un peu plus de 30 ans (138, 139, 178) et le transporteur

responsable de cette activité, FolT, a été récemment caractérisé (316). FolT fait partie d'une

nouvelle classe de transporteurs membranaires identifiée exclusivement chez les

procaryotes; les transporteurs ECF (Energy-Coupling Factor) (316). Chaque transporteur

ECF (Fig. 1.13) est composé d'une protéine de liaison au substrat (composante S) et d'un

module de couplage d'énergie (module AT) constitué de deux domaines ATPases

(composantes AA') et d'une protéine transmembranaire conservée (composante T) (88,

316). Les nombreuses composantes S de cette classe de transporteurs ont été classées en 21

familles de protéines et un substrat spécifique a été prédit pour chacune d'elles (316). Pour

un certain nombre de transporteurs (e.g. transporteurs de folate, thiamine, biotine,

riboflavine et pantothenate) la spécificité de substrat a été vérifiée expérimentalement (88,

316).

Substrate

Periplasm

Cytoplasm

Figure 1.13. Organisation schématique des transporteurs ECF. (Tiré de (415)). Un transporteur ECF comporte 4 domaines : 2 domaines transmembranaires dont un de liaison au substrat (S) et 2 domaines de couplage d'énergie (AA').

58

La composante S du transporteur des folates de L. casei, codée par le gène FolT, est

une protéine de 6 domaines transmembranaires ayant une très forte affinité pour les folates

(99) et forme avec un module AT (EcfAA'T) un transporteur actif permettant l'influx de 5-

CHO-THF chez Lactococcus lactis (316). La fonction de FolT a aussi été caractérisée grâce

à l'utilisation d'une souche d'E.coli auxotrophe pour le pABA et naturellement déficiente

pour le transport des folates, où seulement la surexpression à la fois de FolT et du module

EcfAA'T permet au mutant de croître en présence de 5-CHO-THF (316). Des homologues

de la composante S du FolT ont été identifiés principalement chez les Firmicutes qui

comprend plusieurs pathogènes, tels Mycoplasma capricolum, Clostridium novyi,

Streptococus mutans, Bacillus anthracis et Clostridium botulinum (99).

1.5.1.3 Le transporteur de la .V-adénosv (methionine

L'AdoMet est une molécule vitale pour toutes cellules procaryotes et eucaryotes. Ce

metabolite est synthétisé par la methionine adénosyltransférase (MAT), une enzyme

essentielle chez E. coli (401). L'analyse de la séquence du génome de Rickettsiaprowazekii

a révélé la présence de plusieurs pseudogènes, parmi eux le gène metK codant pour MAT

(6, 7). Le gène metK d'une souche de R. prowazekii est inactivé par un codon stop et code

pour une enzyme non fonctionnelle (82). Afin de compenser la perte de la fonction de

MAT, Rickettsia possède un transporteur permettant l'influx de l'AdoMet (381). Ce

transporteur, nommé SAM, a été isolé par criblage fonctionnel sélectionnant pour le

transport de l'AdoMet radioactif. La caractérisation du transporteur a montré que c'est une

protéine de 294 acides aminés, contenant 10 domaines transmembranaires, et qui a une

forte affinité pour l'AdoMet (Km= 4.7 pM) (381). L'homologie de séquence observée entre

SAM et certains membres de la superfamille des transporteurs de metabolites suggère que

celui-ci est aussi membre de cette superfamille (381). La deletion du gène metK chez E.

coli n'a pu être obtenue sans une complémentation par le gène codant pour le transporteur

SAM, confirmant ainsi le rôle essentiel de ce transporteur (82). Par ailleurs, un membre de

la classe des transporteurs ECF pourrait aussi médier le transport de l'AdoMet chez les

bactéries. En effet, une fonction de transport d'AdoMet a été prédite pour la famille

MtsTUV, mais l'activité de transport n'a pas encore été démontrée (88, 316).

59

1.5.2 Chez les levures et les champignons

Grâce à la génération de mutants déficients dans la synthèse des folates on sait

maintenant que les cellules de Saccharomyces cerevisiae peuvent puiser les folates du

milieu extérieur (26, 128). Ces études suggèrent la présence d'un système de transport des

folates chez la levure, mais cet aspect du métabolisme des folates n'a pas été caractérisé.

Quant au transport de l'AdoMet, des études antérieures ont mis en évidence l'existence

d'un système de transport de haute affinité permettant l'influx de l'AdoMet à travers la

membrane plasmique de S. cerevisiae (239, 288) et le transporteur en question, SAM3, a

été identifié et caractérisé (321). Cette dernière étude a aussi mis en évidence l'existence

d'un transporteur putatif de faible affinité (Km= 160 pM) pour l'AdoMet chez la levure

(321). Les vacuoles de S. cerevisiae possèdent aussi un système de transport de faible

affinité (Km= 68 pM) pour l'AdoMet (342), mais le transporteur impliqué dans ce système

n'a pas jusqu'à présent été identifié. Par contre, un transporteur mitochondrial d'AdoMet,

SAM5P, a été caractérisé (209).

Des évidences biochimiques ont montré que le champignon Pneumocystis carinii

possède un système de transport actif de haute affinité (4.5 pM) pour l'AdoMet (226). Par

contre, les auteurs de cette étude n'ont pu mesurer l'activité enzymatique de l'enzyme

MAT et concluent que Pneumocystis carinii est auxotrophe pour l'AdoMet et dépend

exclusivement de l'influx de cette molécule du milieu extérieur (226). Une étude récente a

mis en doute cette auxotrophic puisque la purification et la caractérisation biochimique de

l'enzyme MAT de P. carinii ont démontré que celle-ci est bel et bien fonctionnelle (181).

Jusqu'à présent, le seul organisme dont le gène de MAT a été inactivé et qui dépend

exclusivement d'une source exogène d'AdoMet pour sa survie est la bactérie Rickettsia

prowazekii (82, 381).

1.5.2.1 Le transporteur SAM3

Le transporteur SAM3 a été isolé par complémentation fonctionnelle d'un mutant de

S. cerevisiae incapable d'utiliser l'AdoMet comme source de soufre dû à un défaut au

niveau du transport de cette molécule (321). L'étude des paramètres cinétiques du transport

de l'AdoMet chez la cellule sauvage ainsi que chez la cellule dont le gène codant pour

60

SAM3 a été supprimé a montré que celui-ci correspondait à un transporteur de haute

affinité pour l'AdoMet (321). La protéine SAM3 est constituée de 12 domaines

transmembranaires et appartient à la famille de permeases aux acides aminés (321).

Récemment, il a été démontré que SAM3 a aussi la capacité de transporter les polyamines

(putrescine et spermidine) (385) mais avec une faible affinité et une faible capacité de

transport comparativement à l'AdoMet. La surexpression de SAM3 chez la levure conduit à

une hypersensibilité à la sinéfungine, indiquant que SAM3 transporte aussi l'inhibiteur

(421).

1.5.2.2 Le transporteur SAM5P

La protéine SAM5P, connue aussi sous le nom de PET8, correspond à un

transporteur mitochondrial de l'AdoMet (209). Lorsqu'il est reconstitué en liposome,

SAM5P peut fonctionner comme un uniporteur permettant l'import de l'AdoMet dans une

seule direction et comme un antiporteur qui échange l'AdoMet extérieur contre l'AdoMet

ou l'AdoHcy intérieur (209). Une cellule de levure dont le gène YNL003c codant pour

SAM5P a été supprimé est auxotrophe pour la biotine dû à un manque d'AdoMet dans la

mitochondrie (209). En effet, ce phénotype peut être complémenté soit par la surexpression

du transporteur SAM5P ou bien par celle de l'enzyme methionine adénosyltransférase

(MAT) cytosolique à l'intérieur de la mitochondrie, démontrant ainsi l'importance du

transporteur SAM5P dans le métabolisme de la biotine (209). Des orthologues de SAM5P

ont été retrouvés chez d'autres cellules eucaryotes incluant les mammifères (1),

Arabidopsis thaliana (40, 267) et les trypanosomatides (67).

SAM5P appartient à la famille des transporteurs mitochondriaux (MCF pour

Mitochondrial Carrier Family) (revue dans (8, 266, 291)). Les transporteurs de la MCF

assurent le transport spécifique d'une variété de molécules (e.g. acides aminés, nucleotides,

coenzymes, intermédiaires du cycle de Krebs) de l'espace intermembranaire vers la

matrice, ou inversement (8, 266, 291). Certains membres de cette famille se retrouvent

aussi au niveau des membranes des organelles telles les hydrogénosomes, les peroxysomes,

les chloroplastes et le reticulum endoplasmique (40, 87, 190, 268). Tous les transporteurs

de la MCF présentent une structure tripartite composée d'une répétition de trois domaines

61

homologues d'une taille d'environ 100 résidus (Fig. 1.15). Chaque domaine contient deux

hélices a transmembranaires jointe par une boucle hydrophile, et un motif conservé

(PX[D/E]XX[R/K]). Les deux extrémités N- et C-terminales sont situées du coté

cytosolique (266, 291).

Cytosol

HjN

J J J J J J J J J Matrix

rrs COOH

Figure 1.14. Modèle topologique des membres de la MCF. (Tiré de (291)).

Tous les membres de la MCF sont formés de 6 hélices a transmembranaires (I-VI) organisées en trois domaines (A, B et C). Les trois domaines sont connectés par une petite boucle hydrophile (a et b). Les deux extrémités N- et C-terminales sont situées dans le cytoplasme.

1.5.3 Chez les protozoaires

Des évidences biochimiques montrent que les parasites de la famille des

apicomplexes comme Toxoplasma gondii et Plasmodium falciparum possèdent un système

de transport actif et spécifique pour les folates (211, 399), mais l'identité du transporteur

impliqué dans ce système est inconnue. Par contre, le génome de ces deux parasites code

pour des transporteurs de la famille FBT, évoquant la possibilité qu'un membre de cette

famille soit impliqué dans le transport des folates (211, 399). Chez les trypanosomes (e.g.

62

Trypanomosa brucei, Trypanomosa rhodesiense), les travaux de Goldberg et al. ont mis en

évidence l'existence d'un système de transport spécifique pour l'AdoMet (114, 116, 117).

Ce système a une faible affinité (de l'ordre du mM) pour l'AdoMet et il est insensible aux

inhibiteurs métaboliques indiquant que l'accumulation d'AdoMet se fait par un transporteur

facilité (114, 117).

1.5.4 Chez les plantes

Trois types de transporteurs de folate ont été caractérisés chez les cellules végétales;

cela inclus les deux transporteurs de l'enveloppe plastidiale et un transporteur localisé au

niveau de la membrane des vacuoles. Par contre, un seul transporteur d'AdoMet a été

caractérisé et celui-ci a été localisé aussi bien au niveau de l'enveloppe des chloroplastes

qu'au niveau de la membrane des mitochondries.

1.5.4.1 Le transport des folates

Des études antérieures ont montré que les cellules d'Arabidopsis ont la faculté de

puiser certains folates dans le milieu de culture, ce qui suggère l'existence d'un système de

transport des folates au niveau de la membrane plasmique de la cellule (292, 317). Deux

transporteurs appartenant à des familles différentes et localisés au niveau de l'enveloppe du

chloroplaste ont été caractérisés (29, 169). Le premier transporteur, codé par le gène

At2g32040, est un membre de la famille des transporteurs de folate et de la bioptérine

(FBT) (169). La fonction de ce transporteur a été mise en évidence en même temps que

celle du transporteur slr0642 et en utilisant la même stratégie. Les auteurs avaient montré

que les deux protéines transportaient la forme monoglutamylée de folate (ainsi que le

methotrexate) mais pas la forme triglutamylée (169). Il faut préciser qu'en plus du

transporteur At2g32040, le génome d'Arabidopsis thaliana code pour 8 autres membres de

la famille FBT dont 5 ne semblent pas transporter le folate, ce qui suggère un rôle dans le

transport d'autres types de substrats (100).

Le deuxième transporteur plastidial, nommé AtFOLTl, appartient à la famille des

transporteurs mitochondriaux (MCF) (29). La protéine AtFOLTl présente une forte

homologie de séquence (40 % d'identité) avec le transporteur mitochondrial de folate

63

identifié chez l'humain (29). Par la complémentation fonctionnelle des cellules de l'ovaire

du hamster chinois (cellules CHO) auxotrophes pour la glycine (dû à une absence de

transport de folate à l'intérieur de la mitochondrie) ainsi que des cellules d'il, coli

auxotrophes pour le pABA, il a été démontré que AtFOLTl peut médier le transport du

folate (29).

Les mutants déficients pour chacun des deux transporteurs ne diffèrent pas

significativement des plantules sauvages en termes de la croissance, de la morphologie, de

la couleur des feuilles, de la photosynthèse et du contenu en folates dans les chloroplastes.

Ceci indique donc que l'absence d'un transporteur peut être compensée par le deuxième (29,

169). Cependant, on ne peut pas exclure la présence d'autres transporteurs de folate au

niveau du chloroplaste.

Les folates sont aussi présents dans d'autres compartiments de cellules végétales

tels les mitochondries et les vacuoles (134) ce qui implique la présence d'un système de

transport des folates dans ces organelles. Le génome d'Arabidopsis thaliana code pour

plusieurs transporteurs de la famille des protéines de multirésistance aux médicaments

(MRP) et certains membres tels MRP1 et MRP2 ont été localisés au niveau de la membrane

des vacuoles (300). Des expériences de transports effectuées sur des vésicules de

membranes vacuolaires surexprimant le transporteur MRP1 ont permis de montrer que ce

dernier avait la capacité de transporter le folate monoglutamylé et l'antifolate MTX en

utilisant l'ATP comme source d'énergie (300). Par contre, le folate polyglutamylé n'est que

très faiblement transporté par MRP1 (300).

1.5.4.2 Le transport de la 5-adénosylméthionine

Jusqu'à présent les études ont rapporté que les cellules de plantes synthétisent

l'AdoMet dans le cytosol (135), ce qui indique que les organelles doivent importer

l'AdoMet afin qu'il puisse remplir ses fonctions métaboliques notamment les réactions de

methylation. En effet, des études ont mis en évidence l'existence d'un système de transport

de l'AdoMet au niveau des chloroplastes (306) et de l'appareil de Golgi (151). Par la suite,

le transporteur plastidial de l'AdoMet, nommé SAMT1, a été caractérisé (40). Le

64

transporteur SAMT1 appartient à la MCF et sa reconstitution en liposomes permet de

montrer qu'il fonctionne comme un antiporteur AdoMet/AdoMet et AdoMet/AdoHcy (40).

L'inactivation du gène SAMT1 chez les plantes cause un important retard au niveau de la

croissance et a permis de montrer que le transport d'AdoMet par SAMT1 est nécessaire

pour le métabolisme des prényllipides, notamment pour la voie de biosynthèse de la

chlorophylle (40). De façon surprenante, une autre étude menée par le groupe de Palmierie

a révélé que SAMT1, lorsqu'il est fusionné à la protéine fluorescente verte (GFP), a été

localisé au niveau de la mitochondrie chez les protoplastes d'Arabidopsis transformés

transitoirement (267). Bouvier et al. ont fusionné la partie N-terminale (80 premiers acides

aminés) de SAMT1 avec la GFP et ont montré que la protéine chimère est localisée au

niveau du chloroplaste (40) tandis que le groupe de Palmierie a fusionné le gène de la GFP

en C-terminale de la séquence complète de SAMT1 (267). Bien que les différentes

stratégies expérimentales utilisées puissent expliquer ces résultats contradictoires, des

études supplémentaires sont nécessaires pour démontrer sans équivoque que SAMT1

possède une double localisation, à la fois mitochondriale et plastidiale.

1.5.5 Chez les mammifères

Les systèmes de transport des folates sont très bien connus chez les mammifères. En

effet, plusieurs types de transporteurs de folate ont été identifiés et caractérisés. Par contre,

excepté le transporteur mitochondrial de l'AdoMet, jusqu'à présent aucun autre transporteur

d'AdoMet n'a été identifié chez les mammifères.

1.5.5.1 Le transport des folates

Les différents types de transporteurs spécifiques au folate chez les mammifères sont

le transporteur de folate réduit (RFC), les récepteurs de folate (RF), le transporteur de folate

couplé aux protons (PCFT) et le transporteur mitochondrial de folate (MFT).

1.5.5.1.1 Le transporteur de folate réduit

Les formes réduites de folates sont majoritairement transportées par une protéine

nommée transporteur de folate réduit (RFC). Le RFC, nommé également SLC19A1, forme

65

avec deux autres protéines (SLC19A2, SLC19A3) la famille des transporteurs de solutés 19

(SLC19) (107). Même si SLC19A2 (THTR1) et SLC19A3 (THTR2) partagent une bonne

homologie de séquence (environ 40 % d'identité) avec le RFC, ces deux protéines ne

transportent pas les folates. En effet, SLC19A2 (THTR1) et SLC19A3 (THTR2) sont

spécifiquent à la thiamine, tandis que RFC a la capacité de transporter les formes

phosphorylées de la thiamine (86, 301, 416, 417). Le gène codant pour le RFC a été isolé

pour la première fois chez la souris (80) suivi par la caratérisation du RFC du hamster (405)

et du l'humain (295, 404, 409). Le RFC est un transporteur facilité de folate et possède des

affinités différentes avec les différentes molécules de folates. Les RFC humains ont une

forte affinité (Km ~ 2-7 pM) pour les folates réduits (e.g. 5-methyl-THF, 5-formyl-THF) et

le methotrexate comparativement à l'acide folique (K{ ~ 150-200 pM) (119). Le

fonctionnement de RFC ne requiert pas l'énergie résultant de l'hydrolyse de l'ATP, et il

n'est pas dépendant du Na+ ou des protons (118, 137). Par contre, le transport médié par le

RFC est très sensible au gradient transmembranaire d'anions, en particulier le gradient de

phosphate organique. Les phosphates organiques sont fortement concentrés dans les

cellules où ils sont synthétisés dans une réaction ATP-dépendante et sont largement

retenus. La distribution assymétrique de ces ions à travers la membrane fournit la force

motrice de l'influx de folates par les RFCs (118). Le RFC est exprimé dans une grande

variété de tissus autant normaux que cancéreux. Certains organes tels l'intestin et le foie ont

une très forte expression de ce gène alors que pour d'autres (cœur, muscles squelettiques),

celle-ci est beaucoup plus faible (402).

La protéine RCF est constituée de 12 domaines transmembranaires (TMDs) avec

une orientation cytoplasmique des extrémités N- et C-terminales (Fig. 1.16) (49, 102, 192).

Le RCF humain possède un site de N-glycosylation (Asn58) dans la boucle connectant le

TMD1 et le TMD2 (410). La grande boucle qui relie le TMD6 à TMD7 est peu conservée

entre les différentes espèces de mammifères et peut être carrément remplacée par un

domaine non homologue du transporteur SLC19A2 (193). Lorsque les parties TMD1-

TMD6 et TMD7-TMD12 du RFC ont été simultanément surexprimées dans les cellules

humaines RFC1', elles étaient dirigées vers la surface de la membrane plasmique et

restauraient l'activité de transport (408). Par conséquent, le rôle principal de la boucle du

66

TMD6/TMD7 est de fournir l'espace approprié entre les segments TMD1-TMD6 et TMD7-

TMD12 pour un transport optimal (408).

Figure 1.15. Topologie membranaire du transporteur de folate réduit. (Tiré de (419)).

Des études de structure-fonction par mutagénèse dirigée ont permis de montrer

l'importance des résidus conservés, situés dans plusieurs domaines transmembranaires

(TMD1, TMD2, TMD3, TMD4, TMD8, TMD10 et TMD11) dans l'activité de transport

(213). L'utilisation du TV-hydroxysuccinimide de [3H]méthotrexate dans des expériences de

marquage par photoaffinité a montré l'implication de la Lys411 du TMD11 dans la liaison

avec le groupement y-carboxyl du substrat (78). Des études récentes ont suggéré que

certains résidus situés dans les TMDs 4, 5, 7, 8 et 10 sont structurellement ou

fonctionnellement importants pour la formation d'une cavité hydrophile putative de liaison

au substrat (147, 148).

67

1.5.5.1.2 Les récepteurs de folate

Un autre système permettant le transport des folates est composé de trois isofomes

de récepteurs de folate (FRs), désignés RFa, RF|3 et RFy, liant les folates avec une haute

affinité. Ces protéines partagent une forte homologie de séquence (68-79 % d'identité), leur

taille varie entre 229 et 236 acides aminés et elles ont entre 2 et 3 sites de N-glycosylation

(97, 156, 198, 305, 326, 329). Les FRa et FRp sont ancrés à la membrane plasmique par

une molécule de glycosylphosphatidylinositol (GPI) alors que le FRy est sécrété (156, 198,

329, 353). Les FRs ont une très haute affinité pour l'acide folique (Kj 1-10 nM) (154) et

internalisent les folates par un mécanisme classique d'endocytose (156, 157, 198, 320,

329). Le FRa est exprimé dans les cellules épithéliales du rein, du plexus choroïde, de la

rétine, de l'utérus et du placenta (277, 329). Il est aussi exprimé dans les tumeurs,

particulièrement dans les carcinomes ovarien et utérin (277). De son côté, le FRP est

exprimé au cours de la myélopoïèse normale et on le retrouve dans le placenta, la rate, le

thymus, les monocytes CD34+ et dans les cellules de leucémie myéloïde aiguë et chronique

(305, 308, 318, 397). Le FRy, quant à lui, n'est exprimé que dans les tissus

hématopoïétiques (353). Les récepteurs de folate jouent un rôle important dans le transport

de folates au niveau de certains organes comme les reins (36), le placenta (294, 367, 368) et

le plexus choroïde (143, 303, 304, 411).

1.5.5.1.3 Le transporteur de folate couplé aux protons

Le transporteur de folate couplé aux protons (PCFT) a été découvert récemment

(243, 297, 386). Le PCFT (SLC46A1) fait partie de la famille des transporteurs de solutés

SLC46 qui regroupe deux autres membres de fonction inconnue, SLC46A2 et SLC46A3.

Le PCFT a été isolé initialement comme étant le transporteur intestinal pH indépendant de

Thème ayant une faible affinité (Km= 125 pM); il a été désigné sous le nom de HCP1

(heme carrier protein 1) (352). Cependant, des évidences suggèrent que les folates sont les

substrats physiologiques majeurs du PCFT : une affinité plus élevée pour les folates

comparativement à l'hème, une grande spécificité pour le folate (incluant une

stéreospécificité pour le 5-formyl-THF) et l'antifolate MTX et finalement, le rôle

étiologique de la protéine mutée dans le syndrome de malabsorption du folate héréditaire

68

(HFM) (243, 297, 386). Le PCFT est électrogénique, fonctionnerait comme un symporteur

HVfolate et son activité de transport est optimale à pH acide (297, 298, 386, 420)

Le profil d'expression de PFCT dans les différents organes humains fournit des

indices quant à ses rôles fonctionnels. Les niveaux d'ARNm de SLC46A1 sont élevés dans

l'intestin grêle, les reins, le foie, le placenta, la rétine et le cerveau. Dans l'intestin, PFCT

est fortement exprimé dans le jéjunum proximal et le duodénum (152, 297, 298). Les

données sur la structure secondaire du PCFT commencent à émerger. L'analyse du profil

d'hydrophobicité a prédit une protéine avec 12 domaines transmembranaires (TMD) et qui

possède des extrémités N- et C-terminales orientées vers le cytoplasme (Fig. 1.17).

L'analyse par immunofluorescence de la protéine fusionnée à 1'epitope hémagglutinine

(HA) a confirmé la topologie des extrémités N- et C-terminales (298, 387). Les deux sites

de N-glycosylation (N58, N68), situés dans la boucle connectant les TMDs 1 et 2 ne

semblent pas jouer de rôle dans le trafic ou la fonction de la protéine (387).

G65AfsX25 C66X

R113S R113C

P425R

Plasma membrane

COOH

Cytoplasm

Figure 1.16. Structure secondaire prédite du PCFT. (Tiré de (419)). Les positions des mutations provenant de patients avec le syndrome de malabsorption du folate héréditaire (HFM) sont indiquées dans la séquence de PCFT.

69

1.5.5.1.4 Le transporteur mitochondrial de folate

L'existence d'un système de transport de folate à l'intérieur des mitochondries

isolées du rat est connue depuis de nombreuses années (75, 146). Le transporteur

mitochondrial de folate de l'humain (hMFT), caractérisé récemment, est membre de la

MCF (266). Le hMFT a été isolé grâce à l'utilisation des cellules de l'ovaire du hamster

chinois (CHO) auxotrophes pour la glycine (glyB) et incapables de médier le transport des

folates à l'intérieur des mitochondries. En effet, lorsque les cellules CHO glyB ont été

transfectées par une banque d'ADN complémentaire de placenta humain, l'expression d'un

gène codant pour le hMFT complémentait l'auxotrophie pour la glycine (376). D'autres

études ont démontré que la mutation G192E située dans le domaine transmembranaire 4 du

transporteur MFT des cellules CHO glyB inactivait le transport mitochondrial de folate

conduisant ainsi au phénotype glyB (217). La transfection des cellules CHO glyB par

l'ADN complémentaire du MFT de hamster des cellules CHO sauvages entraine une

prototrophic pour la glycine et restaure le transport mitochondrial des folates (217). La

modélisation par homologie basée sur la structure cristallographique du transporteur

mitochondrial d'ADP/ATP bovin et des études de mutagénèse dirigée suggèrent que la

mutation G192E affecte vraisemblablement la liaison au substrat (280). Le mutant

MFT(R249A) était incapable de complementer le phénotype glyB. Ce mutant ainsi que le

mutant MFT(G192E) (glyB) ont montré une déficience sévère dans le transport

mitochondrial de 5-formyl-THF comparativement au MFT sauvage (280). Le fait que les

mitochondries des cellules CHO glyB sont sévèrement déficientes dans le transport du

folate laisse sous-entendre que le MFT est possiblement l'unique transporteur de ce

cofacteur dans cette organelle. La distribution de ce transporteur dans d'autres types de

cellules ou organes n'a pas été rapportée. Une étude avait cependant suggéré la localisation

du transporteur de folate réduit (RFC) au niveau de la membrane de la mitochondrie des

cellules de leucémie humaine (380), mais à ce jour, aucune autre étude n'a montré la

présence d'un tel transporteur au niveau de la mitochondrie chez d'autres cellules ou

organes.

70

1.5.5.1.5 Autres types de transporteurs de folate chez les mammifères

En plus des transporteurs hautement spécifiques pour les folates, il existe aussi

d'autres routes potentielles de transport de ces composés. Certains membres de la famille

SLC21 (transporteurs d'anions organiques (OAT)) et de la famille SLC22 (transporteurs

d'anions et de cations organiques) (130, 171, 347) peuvent aussi transporter les folates et

l'antifolate MTX. Ces deux familles sont exprimées dans plusieurs organes comme

l'intestin, le foie et le rein. Les deux membres de la famille SLC21, OAT-K1 et OAT-K2,

sont localisés spécifiquement dans le rein et sont exprimés au niveau des microvillosités de

la membrane apicale. L'affinité de ces transporteurs pour le MTX et le 5-methyl-THF est

d'environ 2 pM et pourraient jouer un rôle dans la réabsorption des folates dans le tubule

proximal (212). Les transporteurs OAT1, OAT2 et OAT3 appartiennent à la famille SLC22

et sont exprimés dans la membrane basolatérale des tubules rénaux (313). Ces transporteurs

ont généralement une faible affinité (10-700 pM) pour le MTX, dépendamment du système

d'expression utilisé (54, 253, 369, 388, 390).

Il existe aussi des protéines médiant l'efflux des folates et du MTX vers l'extérieur

de la cellule. Les protéines de type ABC (ATP-binding-cassette) telles les protéines de

multirésistance aux médicaments (MRP), MRP1-MRP5 (ABCC1-ABCC5), et la protéine

du cancer du sein impliquée dans la résistance BCRP (ABCG2), auraient une grande

capacité à transporter les folates et le MTX, mais avec une faible affinité (Km ~ 0.2 - 2 mM)

(13, 177, 403). Les MRPs ne transportent pas les substrats polyglutamylés (57, 414) ce qui

démontre l'importance de la polyglutamylation dans la rétention intracellulaire des folates.

La localisation des différentes protéines MRP dans la membrane apicale ou basolatérale des

cellules épithéliales montre la grande implication de ces protéines dans le transport

vectoriel des folates dans différents organes comme le rein, l'intestin et le foie (105, 174,

232,319,336).

1.5.5.2 Le transport de la .S-adénosylméthionine

Bien que plusieurs cellules eucaryotes possèdent un système qui permet de

transporter activement l'AdoMet à l'intérieur de la cellule, aucune étude n'a rapportée

l'existence d'un tel système au niveau de la membrane plasmique des cellules mammifères.

71

Les études pharmacocinétiques ont révélé que l'AdoMet est absorbé par la muqueuse

intestinale chez l'animal ainsi que chez l'humain mais que sa biodisponibilité systémique

est faible (37, 360, 361). Une étude récente a démontré que le transport de l'AdoMet à

travers les cellules épithéliales intestinales (cellules Caco-2) est lent et est assuré par un

mécanisme strictement paracellulaire, et ce sans aucune évidence de l'implication des

transporteurs membranaires (222). Par ailleurs, il n'est pas clair si les cellules du foie

(hépatocytes de rat) transportent l'AdoMet (38, 222). Par exemple, en incubant les

hépatocytes isolés de rat avec 2 ou 50 pM [methyl-1 CJAdoMet, Bontemps et al. ont

observé que celui-ci est utilisé principalement pour la methylation des phospholipides

membranaires sans qu'il soit transporter, quoique moins de 0.2% d'AdoMet radioactif est

retrouvé à l'intérieur des cellules. Ces auteurs concluent que l'AdoMet pénètre

difficilement les hépatocytes, mais qu'il est utilisé pour la methylation des phospholipides à

la surface externe de la membrane plasmique (38). En revanche, McMillan et al., ont

démontré que le transport de l'AdoMet dans les hépatocytes est lent et n'est pas saturable

dans une gamme de concentration de 0.001 à 100 pM. À l'équilibre, la concentration

intracellulaire d'AdoMet radioactif représente moins de 20% de la concentration

extracellulaire (1 pM) (222). Ces résultats suggèrent que les cellules mammifères

dépendent principalement de la voie de biosynthèse pour subvenir à leurs besoins en

AdoMet et n'importent pas des quantités importantes de cette molécule du milieu

extracellulaire.

L'absence de l'enzyme MAT dans les mitochondries des cellules des mammifères

suggère la présence d'un système de transport d'AdoMet dans ces organelles (145). Ce

système a été étudié pour la première fois par Home et al. qui ont révélé que l'entrée de

l'AdoMet à l'intérieur des mitochondries isolées de foie de rat est un processus médié par

un transporteur spécifique puisque le transport est inhibé seulement par la sinéfungine et

l'AdoHcy (145). Le transporteur mitochondrial de l'AdoMet de l'humain (SAMC) a été

identifié par criblage de la banque de séquences ESTs (expressed sequence tag) humains

avec la séquence du transporteur SAM5P de levure (1). La protéine SAMC, composée de

274 acides aminés, est membre de la famille des transporteurs mitochondriaux (MCF). La

reconstitution de SAMC en liposomes a permis de montrer que celui-ci fonctionne

72

principalement selon un mécanisme d'échange de substrat. Par exemple, ce transporteur

permettrait in vivo d'échanger l'AdoMet cytosolique contre 1'AdoHcy mitochondrial (1).

Le gène codant pour SAMC (SLC25A26) est exprimé dans de nombreux tissus humains,

avec une plus haute expression dans le testicule (1).

1.5.6 Chez le ver nematode Caenorhabditis elegans

Deux orthologues du transporteur humain de folate réduit (hRFC), folt-1 et folt-2,

partageant respectivement 40% et 31% d'identité avec le hRFC, ont été identifiés dans le

génome de C. elegans (21). Le clonage et la caractérisation fonctionnelle de folt-1 et folt-2

a mis en évidence que seul folt-1 permet de transporter l'acide folique. La protéine folt-1 a

une haute affinité pour l'acide folique (Km= 1.23 pM) et une grande capacité de transport à

un pH acide comparativement à un pH neutre ou alcalin (21). Le transport in vivo de l'acide

folique est fortement réduit chez les vers folt-1" comparativement aux nematodes

sauvages, démontrant l'importance de folt-1 dans le transport de folate (21). De plus,

l'inactivation du gène folt-1 entraine la stérilité du C. elegans hermaphrodite (21) dû à des

défauts dans la prolifération des cellules germinales, et réduit aussi les activités

métaboliques et la longévité du nematode (15). Ces résultats indiquent que folt-1 joue un

rôle important dans le développement des cellules germinales et somatiques de C. elegans

(15).

Le gène folt-1 est fortement exprimé dans les organes du système digestif (pharynx,

intestin) comparativement aux autres tissus du vers nematode, et cette expression est

régulée de façon développementale étant plus élevée au stade larvaire comparativement au

stade adulte. Ces résultats ont été corrélés avec l'observation dans l'intestin de nematode

d'une forte expression de la protéine folt-1 fusionnée à la protéine fluorescente verte (GFP)

au cours des premiers stades de développement par rapport aux derniers (21). L'analyse de

la structure secondaire de folt-1 a révélé une protéine de 10 domaines transmembranaires

(TMD) avec une grande boucle cytoplasmique de 58 acides aminés entre les TMDs 5 et 6,

et les deux extrémités N- et C-terminales situées dans la partie intracellulaire (Fig. 1.18). Le

folt-1 de C. elegans possède deux sites potentiels de N-glycosylation (Asn-36, Asn-260)

(Fig. 1.18).

73

Un orthologue du transporteur mitochondrial de l'AdoMet humain (SAMC) a été identifié

dans une banque de données de C. elegans (numéro d'accession Z68160) (1), mais la

caractérisation de cette protéine n'a pas été rapportée jusqu'à présent.

Asn 36—*

NH*

Figure 1.17. Structure secondaire prédite du transporteur folt-1. (Tiré de (21)).

1.6 Le transport des ptéridines et de l'AdoMet chez Leishmania

Le transport cellulaire des ptéridines (bioptérine et folates) et de l'AdoMet chez le

parasite Leishmania est connu depuis plusieurs années, mais seuls les transporteurs des

ptéridines ont été identifiés. Nous avons décrit dans notre laboratoire trois transporteurs de

ptéridines; le transporteur de la bioptérine BT1 et les deux transporteurs de folate (FT5 et

FT1). BT1 et FT1 ont été également décrits par d'autres laboratoires (73, 188). Ces trois

protéines homologues forment une nouvelle classe de transporteurs chez Leishmania; la

famille des transporteurs de folate et de la bioptérine (FBT). Les membres de cette famille

se retrouvent chez les parasites protozoaires, les cyanobactéries, les plantes supérieures

comme Arabidopsis thaliana. Comme indiqué précédemment, la famille FBT a été classée

74

dans la superfamille des facilitateurs majeurs (55). Leishmania compte 13 transporteurs

FBT, mais la fonction de la plupart d'entre eux est inconnue. Déterminer les fonctions des

ces transporteurs nous permettrait de mieux comprendre le rôle de la famille FBT dans le

métabolisme du parasite et d'envisager un jour la possibilité d'exploiter ces protéines dans

un but thérapeutique.

1.6.1 Le transporteur BT1

Le transporteur de la bioptérine BT1 a été isolé par des expériences de clonage

fonctionnel sélectionnant pour la résistance au MTX (179). BT1 est une protéine de 631

acides aminés, comprenant 12 domaines transmembranaires putatifs et localisée au niveau

de la membrane plasmique du parasite. La surexpression de ce transporteur a permis de

montrer qu'il pouvait aussi transporter, dans une moindre mesure, l'acide folique, mais pas

le MTX (179, 188). Cette sélectivité a un impact important sur la résistance au MTX (voir

la section 1.4.1.1). La deletion de BT1 par recombinaison homologue réduit fortement le

transport de la bioptérine démontrant qu'il était le principal transporteur de cette molécule

(179, 188). Le fait que l'ajout de la bioptérine dans le milieu de culture soit obligatoire pour

la survie des souches déficientes en BT1 suggère que celui-ci joue un rôle physiologique

important chez le parasite (74, 179, 188, 272). Chez les promastigotes, l'accumulation de la

bioptérine est plus grande en phase logarithmique de croissance comparativement à la

phase stationnaire où une réduction de plus de 80 % a été observée. De plus, une

augmentation de 30 % dans l'activité de transport ainsi qu'une modification des transcrits

d'ARNm a été observée chez les amastigotes de L. mexicana par rapport aux promastigotes

(73).

1.6.2 Les transporteurs des folates (FT5 et FT1)

La caractérisation du transporteur BT1 a révélé que celui-ci faisait partie d'une

famille multigénique et que certains membres de cette famille étaient délétés chez les

mutants ayant une réduction presque complète de l'influx de l'acide folique et du MTX

(179, 311, 312). L'isolement et le séquençage des fragments d'ADN correspondants a

conduit à la caractérisation de deux transporteurs de folates, nommés FT5 et FT1 (311,

75

312). FT5 est un transporteur de très haute affinité pour l'acide folique (84 nM) mais

possède une faible capacité de transport (311). Les expériences de transport effectuées sur

une souche déficiente en FT5 ont montré que, comparativement à la souche sauvage,

l'influx de Folate/MTX était diminué dans un milieu pauvre en folates (23 nM), mais

aucune différence significative n'a été observée dans un milieu riche en folates (15 pM).

Ces résultats suggéraient donc que FT5 n'était pas le principal transporteur de folate et

qu'un autre membre de la famille multigénique assurait cette fonction. En effet, la

caractérisation de FT1 a montré qu'il correspond à un transporteur de folate de haute

affinité, quoique que moins élevée que FT5, mais possède une grande capacité de transport

(312). L'analyse des mutants de L. infantum déficients en FT1 a montré que près de 75 %

de l'activité de transport de folate était attribuable à FT1 (312). FT1 a également été isolé

chez L. donovani et sa contribution dans l'activité de transport de folate est de 99% (73).

Ceci démontre que FT1 est le principal transporteur des folates chez Leishmania

1.6.2.1 Structure secondaire de FIT

FT1 présente une topologie caratéristique des protéines de la superfamille des

facilitateurs majeurs (MFS) (Fig. 1.14). En effet, la prédiction de la structure secondaire de

FT1 basée sur l'analyse du profil d'hydrophobicité a montré un modèle de 14 domaines

transmembranaires (DTMs) avec une grande boucle cytoplasmique joignant les domaines 6

et 7, et des extrémités N- et C-terminales du côté cytoplasmique. La localisation

cytoplasmique de la partie C-terminale de FT1 a été confirmée expérimentalement (81).

L'analyse de la structure-fonction de FT1 par mutagénèse dirigée des 10 acides aminés

chargés les plus conservés dans l'ensemble des transporteurs de la famille FBT a mis en

évidence le rôle de ces résidus dans la fonction de FT1 (Fig. 1.14). En particulier, plusieurs

résidus situés au niveau des différentes boucles sont soit importants (Kl 16, Kl33, R497,

D529) ou essentiels (D124, R134, E565, D537) pour le transport de l'acide folique. Le

résidu R497 de la boucle cytoplasmique connectant les domaines 10 et 11 est impliqué dans

la liaison au substrat. L'analyse des résidus chargés au niveau des DTMs 4 et 11 a aussi

démontré le rôle essentiel de ceux-ci dans l'activité de transport. L'étude des paramètres

cinétiques des différentes protéines mutées a montré que l'altération de l'activité de

transport est due soit à un changement au niveau de l'affinité (Km) de FT1 pour son substrat

76

ou bien à un changement au niveau de l'efficacité du transport (Vm )̂ (81). Six acides

aminés (Kl 16, D124, D179, R497, D537 et E565) parmi les dix analysés dans cette étude

ont également été mutés dans Slr0642 (respectivement, K85, D93, D149, R309, D348 et

E376), le transporteur de folate de la cyanobactérie Synechocystis (100). Cinq d'entre eux

(K85, D93, D149, R309, D348) sont critiques pour l'activité de transport de slr0642 (100).

Extracellular

Intracellular

Figure 1.18. Topologie membranaire prédite du transporteur FT1. (Tiré de (81)).

FT1 est composé de 14 domaines transmembranaires avec une grande boucle cytoplasmique liant les domaines 6 et 7. Les deux extrémités N- et C-terminales sont localisées dans le cytoplasme. Les résidus étudiés par mutagénèse dirigée sont représentés par des cercles noirs et leur position est indiquée par des chiffres.

1.6.2.2 Régulation de l'expression de FT1

L'activité de FT1 est régulée différentiellement au cours des phases de croissance

chez les promastigotes, ayant une forte activité en phase logarithmique comparativement à

77

la phase stationnaire où l'entrée de folate est fortement diminuée (73, 312). Cette réduction

de l'entrée de folate s'explique par la relocalisation du transporteur de la membrane

plasmique vers un compartiment intracellulaire suivi de sa dégradation spécifique (312).

L'étude du transport de l'acide folique dans les deux stades de vie du parasite

(promastigote et amastigote) a montré qu'il n'y avait pas de différence dans l'activité de

transport. En raison de l'absence d'une sonde spécifique aux transporteurs des folates,

l'établissement d'une corrélation entre le profil d'expression de leur transcrit (par Northern

blot) et la variation dans le transport de l'acide folique s'est révélé être très complexe (73).

1.6.3 Le transport de la S-adénosylmethionine chez Leishmania

Le parasite Leishmania a la faculté de synthétiser de novo l'AdoMet, mais peut

aussi le prélever du milieu extracellulaire (310). Le fait que la biosynthèse de l'AdoMet est

énergétiquement coûteuse (elle consomme une molécule d'ATP), laisse présager que la

contribution du transport dans le pool de l'AdoMet est importante, puisque ça permettrait à

la cellule d'économiser de l'énergie. L'existence d'un système de transport putatif

permettant l'influx de l'AdoMet a été décrit chez plusieurs espèces de Leishmania (17,

186). De plus, il a été démontré que l'AdoMet et la sinéfungine (SNF) partageaient le

même système de transport chez L. donovani (290). Ce système a une haute affinité pour

les deux substrats, présente une cinétique saturable et est dépendant de l'énergie

métabolique et du gradient de protons (17, 186, 290). Contrairement à l'influx de folate qui

est dépendant de la phase de croissance du parasite, le transport de la SNF ne change pas

lors des différentes phases de croissance (186). L'activité constitutive du transporteur

suggère un rôle important dans le métabolisme du parasite. Il est donc important

d'identifier le gène codant pour ce transporteur chez Leishmania.

78

1.7 Problématique, hypothèses et objectifs

1.7.1 Problématique

La leishmaniose constitue un problème de santé majeur dans les pays pauvres du

monde et figure parmi les priorités de l'organisation mondiale de la santé (OMS).

L'absence de vaccin contre cette maladie et les problèmes associés à la chimiothérapie tels

la résistance au traitement, la toxicité et le coût élevé de certaines molécules, ont créé un

besoin urgent de nouveaux médicaments. Il est donc important de trouver de nouvelles

cibles thérapeutiques. La voie métabolique des folates représente une excellente cible

thérapeutique puisqu'elle a déjà été exploitée efficacement, grâce à l'utilisation des

antifolates, dans le traitement de plusieurs maladies comme les infections d'origines

bactériennes, parasitaires, ou néoplasiques. Jusqu'à présent, il n'existe aucune thérapie à

base d'antifolates contre la leishmaniose, mais notre compréhension du métabolisme des

ptérines et des folates chez Leishmania a permis d'identifier plusieurs protéines au potentiel

thérapeutique. En effet, la découverte de la famille des transporteurs de folate et de la

bioptérine (FBT) donne l'espoir que ces protéines puissent être exploitées pour la mise au

point de nouvelles stratégies thérapeutiques.

1.7.2 Hypothèses

Leishmania est auxotrophe pour les ptérines et les folates, mais il a développé un

système de transport qui lui permet de prélever de façon efficace ces cofacteurs du milieu

extérieur et ainsi satisfaire ses besoins métaboliques et physiologiques. Ce système de

transport comprend un transporteur spécifique pour la bioptérine (BT1) et deux

transporteurs spécifiques pour l'acide folique (FT1 et FT5). Ces protéines appartiennent à

la famille des transporteurs de folate et de la bioptérine (FBT). Le génome de Leishmania

code pour 10 autres homologues de ces transporteurs de fonction inconnue.

Puisque le folate et la bioptérine sont les seuls substrats connus de cette famille de

transporteurs, nous avons émis une première hypothèse selon laquelle d'autres membres de

la famille FBT seraient impliqués dans le transport des dérivés du folate ou de la bioptérine

79

et/ou pourraient être différentiellement exprimés chez le parasite. Par ailleurs, puisque les

folates jouent un rôle essentiel dans le métabolisme monocarboné et que celui-ci est

compartimenté chez les cellules eucaryotes, y compris Leishmania, notre hypothèse est

qu'un membre de la famille FBT pourrait correspondre à un transporteur de folate localisé

au niveau de la membrane des organelles telle la mitochondrie. Chez les mammifères le

transport de folates à travers la membrane de la mitochondrie est assuré par un membre de

la famille des transporteurs mitochondriaux (MCF) et Leishmania possède des orthologues

qui pourraient potentiellement être impliqués dans le transport de folate au niveau de la

mitochondrie du parasite.

Les folates et la 5-adénosylméthionine (AdoMet) sont des donneurs d'unités Cl

dans la cellule. Des études protéomiques et transcriptomiques ont suggéré l'implication de

l'AdoMet dans la résistance à l'antifolate methotrexate (MTX) chez Leishmania. D'un

autre coté, nous avons observé dans le laboratoire une résistance croisée à la sinéfungine

(SNF), un analogue structural de l'AdoMet, chez un mutant sélectionné pour la résistance

au MTX. En raison des réarrangements au niveau des gènes de la famille FBT chez ce

mutant, nous avons émis l'hypothèse que celle-ci aurait probablement un rôle à jouer dans

la résistance à la SNF et qu'un nouveau membre FBT qui est réarrangé chez le mutant

pourrait correspondre à un transporteur de l'AdoMet.

1.7.3 Objectifs

Les travaux présentés dans cette thèse avaient comme objectif principal la

caractérisation de la famille des transporteurs de folate et de la bioptérine (FBT) et plus

spécifiquement :

La première partie (Chapitre II) avait comme objectifs 1) d'identifier toutes les

protéines appartenant à la famille FBT et d'effectuer une analyse phylogénique et 2) de

mesurer l'expression des 14 gènes de la famille FBT aux i) différentes phases de croissance

chez les deux stades de vie du parasite (promastigote et amastigote) et ii) chez des mutants

hautement résistants au methotrexate.

80

La deuxième partie (Chapitre III) avait comme objectif de caractériser la fonction

d'un nouveau membre de la famille FBT qui était réarrangé chez des mutants résistants à la

sinéfungine.

La troisième partie (Chapitre IV) avait comme objectif d'étudier la localisation

subcellulaire des différents membres de la famille FBT du parasite L. infantum ainsi que

quelques protéines de la famille des transporteurs mitochondriaux (MCF) dans le but

d'identifier et de caractériser les transporteurs de folate et/ou de l'AdoMet qui seraient

localisés au niveau de la membrane de la mitochondrie.

81

Chapitre II. Analyse fonctionnelle et réarrangements géniques complexes des gènes de la famille des transporteurs de folate et de la bioptérine (FBT) chez le parasite protozoaire Leishmania

Le contenu de ce chapitre à fait l'objet d'une publication dans la revue Molecular and

Biochemical Parasitology (2008) 162(2): 155-64.

2.1 Résumé

Le parasite protozoaire Leishmania est auxotrophe pour l'acide folique. Des études

antérieures ont rapporté la caractérisation du principal transporteur de folate (FT1) de

Leishmania. FT1 est membre de la famille des transporteurs de folate et de la bioptérine

(FBT). Parmi tous les organismes séquences, Leishmania est celui qui possède le plus

grand nombre de protéines FBT (codées par 14 gènes). Nous avons développé une

approche par TaqMan RT-PCR en temps réel afin de mesurer l'expression des gènes FBT

de Leishmania infantum lors des différentes phases de croissances et stades de vie du

parasite ainsi que chez certains mutants hautement résistants au methotrexate. Ainsi, nous

avons observé que FT1 est préférentiellement exprimé en phase logarithmique de

croissance, ce qui est en corrélation avec l'accumulation plus élevée des folates au cours de

cette phase. De plus, les niveaux d'ARNm de FT1 semblent répondre à la concentration de

l'acide folique dans le milieu. Plusieurs gènes FBT sont exprimés préférentiellement en

phase stationnaire de croissance, caractérisée par une accumulation minimale d'acide

folique. Cela suggère que ces membres FBT pourraient transportés d'autres substrats. Cette

étude a permis d'associer la résistance au methotrexate à l'inactivation de FT1 et à la

surexpression d'autres gènes FBT. L'inactivation de FT1 est due soit à une deletion génique

médiée par une recombinaison homologue entre les séquences conservées des gènes FBT

ou par conversion génique. Cette étude a mis en évidence la multiplicité des gènes FBT de

Leishmania, leur expression complexe ainsi que de nouveaux événements de

recombinaison géniques associés à l'inactivation de FT1 et à la résistance à l'antifolate.

82

2.2 Article

Functional analysis and complex gene rearrangements of the folate/biopterin

transporter (FBT) gene family in the protozoan parasite Leishmania

Amin Ahmed Ouameur, Isabelle Girard, Danielle Légaré and Marc Ouellette*

Centre de Recherche en Infectiologie du CHUL, Université Laval, Québec, Canada

* Corresponding author : Marc Ouellette Ph.D. Centre de Recherche en Infectiologie du CHUL 2705, Boulevard Laurier Québec, Québec G1V4G2 Tel : 1-418-654-2705 Fax: 1-418-654-2715 Email : Marc.Ouellette@crchul.ulaval.ca

Running title: Folate transporters expression profiling in Leishmania

Keywords: Folate transporters; Methotrexate; Homologous recombination; Leishmania; Gene conversion

83

Abstract

The protozoan parasite Leishmania is a folic acid auxotroph. Previous work has led

to the characterization ofthe main folate transporter FT 1. FT 1 is part ofthe folate/biopterin

transporter (FBT) family and Leishmania with its 14 members is, of all sequenced

organisms, the one with the most FBTs. We developed a real-time TaqMan RT-PCR assay

to follow the expression of these FBT genes during growth phases, life cycles and in

methotrexate-resistant mutants of Leishmania infantum. FT1 is expressed preferentially in

the logarithmic phase which is consistent with the higher accumulation of folate in that

stage. FT1 RNA levels even seemed to be related to folate concentration in the medium.

Surprisingly, several ofthe FBT genes were expressed preferentially in the stationary phase

of growth, a stage with minimal folate accumulation. It suggests that these FBT members

may transport other related substrates. Resistance to methotrexate is associated with FT1

inactivation and upregulation of other FBT genes. Inactivation of FT1 is due either to a

gene deletion mediated by homologous recombination between conserved FBT sequences

or by segmental gene conversion. This study highlighted the multiplicity of FBT genes in

Leishmania, their complex RNA expression, and novel gene rearrangements associated

with FT1 inactivation and antifolate resistance.

84

Introduction

Leishmania are protozoan parasites distributed worldwide and, depending on the

species, can cause clinical symptoms encompassing cutaneous, mucocutaneous and visceral

leishmaniasis (1, 2). The treatment regimen relies on chemotherapy with the antiquated

pentavalent antimonials still remaining the mainstay (1, 2). However resistance to

antimonials in some parts of the world is now widespread and alternate treatments are

required (reviewed in 3 and 4). Antifolates have a long success story in the fight against

infectious diseases (5, 6) but this class of molecules, despite some interesting leads (7, 8, 9,

10), is not yet useful against Leishmania. A better understanding of folate metabolism in

this parasite may help in finding better active molecules. Reduced folates are one carbon

donor in cellular metabolism and antifolates alter these pathways including the synthesis of

thymidine. Leishmania is a folate auxotroph and needs to import this molecule to meet its

folate requirements (11, 12).

Most of our understandings of folate (and pterin) metabolism in Leishmania are

derived from studies of the mechanism of resistance to the model antifolate drug

methotrexate (MTX) (reviewed in (11, 12)). Studies of MTX resistance have highlighted

that a common resistance mechanism consisted of a reduction in folate/MTX uptake (13,

14, 15). This reduction can be quite pronounced and, despite their auxotrophy, Leishmania

cells thrive remarkably well in culture flasks even with no measurable folate accumulation.

Functional cloning experiments and selection for MTX resistance has pinpointed a gene

coding for a membrane protein now named BTI, which was found to be the only biopterin

transporter of Leishmania (16, 17). BTI was also showed to be able to transport, albeit

much less efficiency, folic acid but not MTX (16). This ability to selectively transport folic

acid is a likely explanation that the overexpression of BTI, at least in folate-rich medium

(16, 18), can lead to MTX resistance. BTI was found to be part of a large gene family (19,

20) and at least two other members of this gene family have been functionally

characterized. FT5 was shown to be a high affinity and low capacity folate transporter (19)

and FT1 was found to be the main folate transporter of Leishmania (20, 21).

BTI, FT5 and FT1 form a novel class of membrane transporters that are found in

Trypanosomatids, in the Apicomplexan parasites, higher plants, and Cyanobacteria. These

85

proteins are now included in the FBT family which is distantly related to the major

facilitator superfamily. Folate transport is now well established in the Apicomplexa

Plasmodium falciparum (22) and Toxoplasma gondii (23) parasites and it is possible that

members of the FBT family are responsible for these activities as their genomes have

revealed homologues of the Leishmania FBT proteins. The only other member of the FBT

family that was functionally characterized was derived from the plant Arabidopsis

At2g32040 and the Cyanobacteria Synechocystis slr0642. Both proteins were shown to

transport folic acid and the Arabidopsis transporter was localised to the envelope of

chloroplasts (24). The sequences of genomes of several pathogenic Trypanosomatids (e.g.

L. major, T. brucei, and T. cruzi) axe now completed and this has highlighted an expansion

ofthe FBT family in Leishmania. More than 14 homologues are present in L. major and L.

infantum and we present here a detailed comparison of the expression of these genes in

Leishmania and of their complex rearrangements upon resistance to MTX.

Materials and methods

Cell lines and culture conditions

L. infantum (MHOM/MA/67/ITMAP-263) wild-type promastigote cells was grown

in M199 (containing 23 nM folic acid), SDM-79 (15 pM folic acid) (25) and MAA/20 (57

nM folic acid) (26) media at pH 7.0 and 25 °C. L. infantum axenic amastigotes were grown

at 37 °C and 5% CO2 in MAA/20 as described (26). Cell differentiation was confirmed by

measuring the expression of the amastigote-specific gene amastin (27) and the

promastigote-specific gene PFR2 (28) by real-time RT-PCR. Two independent L. infantum

methotrexate (MTX)-resistant mutants were selected in Ml 99 medium in the presence of

increasing concentration of MTX. The cell line L. infantum MTX1000.3 was obtained by

stepwise selection starting with 150 nM MTX, until cells resisted 1000 pM of MTX. The

cell line LinfMTXlOO.l was obtained in two steps: first by growing L. infantum wild-type

with 1 pM MTX for three passages, then the MTX concentration was increased to 100 pM.

Growth curves were done for all cell lines to determine the exact growth phases of the

parasites.

86

Phylogenic analysis

The FBT protein sequences of Trypanosomatids (Leishmania and Trypanosoma)

were obtained from the GeneDB database (http://www.genedb.org/). Apicomplexa

(Plasmodium, Toxoplasma and Cryptosporidium) homologues to Leishmania FBTs were

identified through BLASTp analysis using the Apicomplexan database resources

(http://www.apidb.org/apidb/). Cyanobacteria and plant (Arabidopsis thaliana) sequences

were found in GenBank (http://www.ncbi.nlm.nih.gov). Alignment of the FBT proteins of

Leishmania, Trypanosoma, Plasmodium, Toxoplasma, Cryptosporidium, Arabidopsis, and

Cyanobacteria, was made using ClustalW (29) with manual optimization. Sequences were

edited to exclude gaps (if needed) with the BioEdit software (30). The phylogram was

constructed using the Neighbor-Joining method (31) with 1000 bootstrap iterations and the

Poisson correction distance method ofthe MEGA package Version 3.1 (32). Phylograms

were also made with only the most conserved portions of FBT members and this led to

similar results as presented here.

Southern blots

Genomic DNA was isolated from log phase Leishmania promastigotes using

DNAzol reagent (Invitrogen). Southern blotting, hybridization, and washing conditions

were performed following standard methods (33). A DNA probe (573 bp) spanning the

conserved coding sequences ofthe FBT gene family was obtained by PCR with primers 5'-

GTGATTGCGAAGGCCAACGTG-3' and 5'-CAGCGGCAGGTTGTCGTAGTTG-3'.

Ptéridine transport experiments

Cells were grown in M199 medium until mid-logarithmic growth phase, then 4 x

107 cells were washed and resuspended in the folate deficient medium fdDMEL (34) in the

presence of 200 nM of radioactive ptéridine. Transport experiments were performed as

described previously (16, 17). Tritium-labelled [3H]folate (43.2 Ci/mmol) and [3H]MTX

(12 Ci/mmol) were purchased from Moravek Biochemicals. The quantity of accumulated

radioactivity was normalized with Leishmania cells numbers. To measure folate and MTX

transport, the uptake of cells incubated on ice was subtracted.

87

DNA construct and transfections

The LinJlO.0410 gene was amplified from genomic DNA of L. infantum using

primers 5 '-TTCTAG AAC ACCTTACC ACG ATGTCC-3 ' and 5'-

AAAGCTTGCTTCACGCGTTGCC-3 '. The PCR fragment was cloned in the pGEM T-

easy vector (Invitrogen), digested with Xbal and HindlH (underlined), and then cloned into

the Leishmania expression vector pSP72ai/TG« (35) to obtain the pSPaHYGa-LinJ10.0410

construct. The pSPaNEOa-LinJl0.0410-GFP construct was made by first cloning the

enhanced GFP (EGFP) gene between the Xbal and Sail site of pSP72aNEOa. LinJ 10.0410

was then amplified by primers 5 '-GGGATCÇCCTTACC ACG ATGTCC-3' and 5'-

TTCTAGACGCGTTGCC-CTGCAC-3 '. which respectively included the start codon and a

Xbal site replacing the stop codon. The PCR product was then cloned in pGEM T-easy

vector, digested with BamHI and Xbal (underlined) and cloned in-frame upstream of the

GFP gene in pSPaNEOa-GFP. Transfection of pSPaHYGa-LinJlO.0410 and pSPaNEOa-

LinJ 10.0410-GFP into Leishmania promastigotes was as described previously (36).

Leishmania cells expressing the LinJ 10.0410-GFP fusion were analyzed by fluorescence

microscopy as described (21). A similar strategy was used for cloning the gene

LinJl9.0870. The primers 5'-GGATCCGAACTAGCAATGACGTTAGAG-3' and 5'-

TCCTTCTAGAATGCTTGCCG-GC-3 '. with BamHI and Xbal sites (underlined), were

used to make the construct pSPaNEOa-LinJ19.0870-GFP, while the primers 5'-

TTCT AGAGAACTAGC AATGACG-TTAGAG-3 ' and 5'-

GGTCGACTCCTTGTTCAATGCTTGCC-3 '. with Xbal and Sail sites (underlined), were

used for the construct pSPaHYGa-LinJl9.0870.

TaqMan real-time RT-PCR

RNA extraction and cDNA synthesis

RNA was isolated from cells in early-logarithmic phase (day 2), mid-logarithmic

phase (day 3), late-logarithmic phase (day 4), stationary phase (day 5) and late-stationary

phase (day 6). Three to four independent RNA preparations were obtained for each

condition. RNA extractions were carried out according to the manufacturer's instructions

88

using the RNeasy Mini Kit Plus (Qiagen). All samples were DNasel treated using the

DNA-free turbo kit (Ambion) to remove possible traces of genomic DNA. The purity, the

integrity and the amount of RNA were assessed on the Agilent 2100 bioanalyzer (Agilent

Technologies). The major criterion for RNA integrity was the presence of three clear

ribosomal peaks (18S, 24Sa and 24SP). The RNA samples were then stored at -80 °C until

use.

First-strand cDNA was synthesized from 2 pg of total RNA using the Superscript II

reverse transcriptase enzyme and 01igo(dT)12-18 primers (Invitrogen) according to

manufacturer's instructions. The resulting cDNA samples were stored at -20 °C until use.

A test amplification was carried out using primers from different internal controls (GAPDH

and actin) to test uniformity of cDNA synthesis in different samples.

Primers and TaqMan probe design

Primers and TaqMan probes were designed using the GenRunner software

(http://www.generunner.com). Specific primers were designed for each gene, and six

different TaqMan probes were designed for 14 FBT genes and an endogenous control gene,

glyceraldehyde-3-phosphate dehydrogenase (GAPDH) (see Table SI, supplementary

material). The TaqMan probes were obtained from Integrated Device Technology (IDT),

and were dual labelled with 5'FAM/3'BHQ molecules for target genes and 5'TET/3'BHQ

molecules for endogenous control gene (GAPDH). In preliminary experiments, primer

concentrations were tested to optimize PCR amplification in multiplex reactions, with a

constant TaqMan probe concentration (100 nM). The primer concentrations were defined at

60 and 300 nM for amplification of GAPDH and FBT genes, respectively.

PCR amplification and quantification

TaqMan PCR assays were performed in a Rotor Gene-3000 (Corbett Research).

Reactions were performed in a total volume of 20 pL, containing 1 pL cDNA sample, 1 *

TaqMan Universal Master Mix (Applied Biosystems), 100 nM of TaqMan probe, 60 and

300 nM of GAPDH and FBT gene primers, respectively. Reactions were carried out with at

least three biological replicates each with two technical replicates. The universal

temperature cycles were as follows: 2 min at 50 °C and 10 min at 95 °C, followed by 35-40

89

cycles of 15 s at 95 °C and 1 min at 60 °C. In addition, we chose four stage-specific genes,

and one internal control gene (actin) which could be used in the normalization process.

PCR amplifications of these genes were performed as described previously (37). The

specificity of the PCR was checked by running the amplicon in an agarose gel and by

sequencing. Controls without reverse transcriptase were run to verify that no contaminating

genomic DNA was present.

Results were quantified by using the relative standard curve method as described in

http://docs.appliedbiosystems.com/pebiodocs/04303859.pdf. The Rotor Gene Analysis

Software (Version 6.0) was used for data analysis. Gene expression levels were measured

in the different samples, and the obtained threshold cycle (CT) values were used to

calculate the initial input amount from the standard curve. The results were normalized to

the endogenous control, GAPDH. For statistical analysis, a Student's t-test and Mann-

Whitney U-test were applied to test for significant differences in gene expression between

samples. The level of significance was set to p < 0.05 in all statistical testing. The

calculations were performed using the software package SPSS for Windows, Version 11.0

(Chicago, IL, USA).

Results

The FBT gene family in Leishmania

Southern blot hybridizations indicated that Leishmania harbours several FBT genes

(19, 20) and the recent completion ofthe L. major (38) and L. infantum (39) genomes has

confirmed this. Multiple searches and Blast analyses have highlighted 14 members part of

the FBT family spread on chromosome 4, 6, 10, 19 and 35 in both sequenced species. A

pseudogene was also present on chromosome 14 of each species (see Fig. 1). Genes are

similarly organized between the two species with usually only one gene per chromosome.

One exception is chromosome 10 with a number of noteworthy features. First, there are two

FBT genes at each telomeric ends. Most interestingly, they are identical, i.e. LmjFl0.0020

is identical to LmjFlO.1310, and are part of a three gene duplication (Fig. 1). This

arrangement was supported by Southern blot analysis that we have carried out (result not

shown). Second, LmjFl0.0350 is listed as a pseudogene in www.genedb.org with two stop

90

codons, while its possible homologue in L. infantum, LinJ 10.0360, is not. While the %

similarity is high between the orthologues of each species (>90%), Lmj 10.0350 and

LinJ 10.0360 are only 70% similar (see Table S2, supplementary material). Third, there is a

cluster of seven FBT genes arranged in tandem in both species (Fig. 1).

The FBT proteins of L. infantum and L. major were aligned with homologous

proteins found in Apicomplexa parasites, Cyanobacteria and plants, and used for

phylogenetic analysis. Of all sequenced organisms, Leishmania is the organism with the

most FBT members. Fig. 2 displays a Neighbor-Joining tree showing the perfect orthology

between the different members in L. major and L. infantum but while homologues of the

FBT family are present in T. brucei and T. cruzi, none could be assigned as orthologous

sequences by phylogenetic analysis (Fig. 2). T. cruzi has notably less FBT transporters than

T. brucei (Fig. 2). The T. gondii FBTs are branching with the kinetoplastid proteins but the

Cryptosporidium and malaria transporters are branching together and are phylogenetically

closer to the plant proteins (Fig. 2). As noted previously (24), the chloroplast A. thaliana

FBT At2g32040 is closer to the Cyanobacteria FBT (Fig. 2).

RNA expression profiling of the Leishmania FBTs

Leishmania has 14 FBTs with only 3 having been functionally characterized. BTI

transports biopterin while FT1 and FT5 transport folic acid with different Vmax and Km.

Folate transport in Leishmania is known to be strongly regulated by the growth phase ofthe

parasite, with maximal transport in actively dividing logarithmic phase promastigotes and

with little transport in stationary phase metacyclic parasites (20, 21, 40). Hybridization

results with non-specific probes also suggest some life cycle specific pattern of gene

expression (20). We developed real-time RT-PCR TaqMan assays for looking at gene

expression ofthe FBT genes from early-logarithmic to late-stationary phases of L. infantum

promastigote and axenic amastigote stages. While there are 14 FBT genes; 12 were studied

by TaqMan assays. Indeed, LinJ 10.0020 and LinJ10.1450 are identical and despite

numerous attempts it has been impossible to generate a gene-specific assay for LinJ 10.0390

(see also below).

91

We measured the expression of control genes to monitor the growth phase and

parasite differentiation (supplementary Fig. SI). As expected, the expression of PTRl (20)

was maximal in logarithmic phase and the expression of META1 (41) was maximal in

stationary phase (supplementary Fig. SI). Similarly and as expected, PFR2 (28) and the

amastin (27) genes were expressed preferentially in the promastigote and amastigote

stages, respectively, as determined by real-time RT-PCR (supplementary Fig. SI).

We initially expected increased expression of several FBT members in actively

dividing parasites. This was clearly only the case for FT1 (LinJ 10.0400), the main folate

transporter (21), and this was true only with the promastigote stage (Fig. 3). The expression

of FT5 (LinJl0.0420) and BTI (LinJ35.5120) were relatively stable between the different

growth stages and life cycles (Fig. 3). There were no FBT genes expressed specifically in

axenic amastigotes, although a two- to threefold higher expression was noted in amastigote-

logarithmic phase for LinJl0.0410 compared to promastigotes. Surprisingly, the expression

of several FBT genes was increased in stationary phase parasites. The most striking

example is for LinJl0.0380 which has 10-fold increased expression in stationary phase of

growth and more than 40-fold increase expression in late-stationary phase (Fig. 3).

We look at the expression in MAA because it allowed us to compare promastigotes

and amastigotes (Fig. 3). Since folate transport activity is dependent on folate concentration

in media, we have checked the expression of the L. infantum FT1, FT5, BTI, and

LinJl 0.0380 genes in other media used for growing Leishmania cells. In general, we

observed the same type of regulation of the different FBT genes in Ml 99 or SDM-79

medium (Fig. 4A). One exception was FT1 in SDM-79 where the difference in expression

between logarithmic phase and stationary phase was less significant (Fig. 4A). This could

be explained because SDM-79 is much richer in folic acid and thus high level expression of

FT1 may not be required under these conditions. For example, at those high concentrations,

BTI could also transport some folic acid (16). To test this, we monitored the expression of

FT1 in M199 medium by adding folic acid. Interestingly, a decrease in FT1 expression was

observed following the addition of 150 nM and 1.5 pM folic acid (Fig. 4B) suggesting that

FT1 expression may respond to the concentration of folic acid within the medium, although

no clear dose response was observed.

92

Expression and rearrangements of FBT genes in MTX-resistant mutants

Studies of resistance mechanisms to MTX have been useful to understand folate

metabolism in Leishmania. Resistance can be due to many genetic alterations including

gene amplifications and gene deletions. The mechanisms of gene amplification have been

well investigated (42, 43) but not the events leading to gene deletion. The development of

TaqMan assays allowing the detection of individual transporter genes has permitted to

monitor the expression of all FBT genes upon the emergence of resistance. Two new L.

infantum MTX-resistant mutants were generated and studied. In both mutants, there was a

marked defect in folic acid and MTX accumulation (Fig. 5A). The expression of all genes

was monitored in L. infantum MTX 100.1 and MTX 1000.3 mutants. In MTX 100.1, we

observed a twofold reduction in FT1 expression, but the absence in expression of

LinJ 10.0380 (Fig. 5B) was even more notable. Some genes were overexpressed; the two

with the highest fold increase were BTI and LinJl9.0870. The expression profiling was

slightly different in MTX1000.3. FT1 expression was not measurable in this mutant and

BTI and LinJl0.0410 were overexpressed (Fig. 5B). The absence of expression of specific

genes in the two mutants could be due either to a marked decrease in RNA levels or to gene

deletion. To test whether gene deletion events were present in these mutants we first

hybridized a Southern blot to a probe covering the conserved regions of FBTs. Clearly,

there was a gene rearrangement event in MTX 100.1 while this could not be demonstrated

for MTX1000.3 (Fig. 6A), a mutant with no measurable FT1 expression (Fig. 5B). Down

regulation in gene expression was affecting selected genes ofthe chromosome 10 locus. We

were not able to generate a TaqMan assay for LinJl0.0390 (Fig. 3) and similarly we could

not design primers for the specific amplification of this gene (Fig. 6C). However, we could

develop primers for the specific amplification of LinJl0.0370, LinJl0.0380, LinJl0.0400

(FT1) and LinJl 0.0410 and PCR bands ofthe expected size were obtained for each gene

when starting with DNA derived from the wild-type cells (Fig. 6C).

For mutant L. infantum MTX 100.1, the LinJl0.0370 and the LinJl0.0410 genes

appeared intact. However, no PCR product was observed for the gene LinJl 0.0380 (Fig.

6C) and some rearrangements seem to have occurred at FT1 since while primers 7-8

(primers used for the TaqMan assay for FT1) gave the expected PCR product, primers 11

93

and 12, amplifying a larger portion of FT1, did not (Fig. 6C). This type of results is

compatible with a deletion of a region between LinJl 0.0380 and FT I. To test this we used

primers 3 and 12 (upstream of LinJl0.0380 and downstream of FT1, respectively) and

indeed we obtained a PCR fragment ofthe expected size in the mutant MTX 100.1 but not

in either WT or MTX1000.3 mutant (Fig. 6C). Our PCR conditions did not allow the

amplification of a fragment >10 kb that would be amplified by primers 3 and 12 in wild-

type cells. We sequenced this fragment (accession number: EU221004) and it was

consistent with a gene deletion event that was mediated by homologous recombination

between stretches of identities (80 bp) between LinJl 0.0380 and FT I (Fig. 6B,

supplementary Fig. S2).

Southern blot analysis of MTX1000.3 did not support a gene deletion event (Fig.

6A). Moreover, the genes LinJlO.0380, FT1 (primers 11-12) and LinJ10.0410 appeared

intact since they gave amplification bands similar to bands obtained from DNA derived

from wild-type cells (Fig. 6C). However, the use of primer pair 7-8 did not lead to a PCR

fragment in this mutant (Fig. 6C). This is consistent with the negative TaqMan assay using

this pair of primers (Fig. 5B). Since FT1 appeared present (Fig. 6A and C with primers 11-

12), the absence of amplification with primers 7-8 may be due to the accumulation of point

mutations spanning sequences recognized by the primers. Sequencing of the PCR

fragments generated with primers 11-12 from wild-type cells and MTX1000.3 indeed

showed the presence of many mutations precluding the annealing of primers 7 and 8 in the

mosaic FT1 gene of mutant MTX1000.3 (supplementary Fig. S3). Examination of the

sequence showed in fact that a stretch of 380 bp derived from LinJ10.0410 had replaced the

corresponding sequence in FT I. This was not the product of a reciprocal double cross-over

exchange since the sequence of LinJ10.0410 in the mutant was intact (supplementary Fig.

S3). Thus the inactivation oiFTl is due to a segmental gene conversion event where a copy

of a segment of LinJlO.0410 replaced a region of FT1 (Fig. 6B and supplementary Fig. S3)

(sequence accession number: EU221005). This conversion event must have occurred at the

level of homologous sequences between FT1 and LinJl0.0410 (supplementary Fig. S3).

This event also explained the increased expression of LinJl 0.0410 in mutant MTX1000.3

(Fig. 5). Indeed, the primers for the qRT-PCR assay for this gene recognized both the

genuine gene but also the mosaic FT1 gene.

94

The LinJ10.0380ILinJ10.0400 fusion protein in L. infantum MTX100.1

(supplementary Fig. S2) or the novel mosaic FT1 protein in L. infantum MTX1000.3

appeared incapable of supporting folate transport as no folic acid accumulation was

observed in these two mutants (Fig. 5A). Similarly, despite that the expression of

LinJ19.0870 in L. infantum MTX100.1 or LinJ10.0410 in L. infantum MTX1000.3 were

increased, there was also no measurable transport of folic acid in these two mutants (Fig.

5 A). The inability ofthe latter two gene products to transport folic acid was formally tested

where both LinJl9.0870 and LinJl0.0410 were cloned in Leishmania expression vectors

and transfected into L. tarentolae MTX 1000.6, a cell line that we use frequently for

studying folate transport. No folate transport could be observed in these two transfectants

under our experimental conditions (supplementary Fig. S4). Longer accumulation times or

higher substrate concentration did not lead to measurable transport as well (not shown).

Transfection of these genes in wild-type cells did not lead to MTX resistance (results not

shown).

Discussion

Leishmania is a folate and pterin auxotroph and it must thus rely on membrane

transporters to meet its folate/pterin requirements. Of all sequenced organisms, Leishmania

has the most FBT members (Fig. 1 and Fig. 2). The main folate transporter is FT1

(LinJ 10.0400) (21) and it is well established that folate accumulation is maximal in actively

dividing parasites (21, 40). The development of gene-specific TaqMan RT-PCR assays has

allowed monitoring the expression of each individual FBT gene. All genes were expressed

in both promastigotes and amastigotes and possibly only LinJl 0.0410 was slightly more

expressed in the axenic amastigote stage compared to the promastigote stage (Fig. 3). We

initially expected several genes to be maximally expressed in log phase but this was only

true for FT1 (Fig. 3). The fold change in gene expression during the growth stages or life

cycles of Leishmania FT5 and BTI genes was not more than twofold (Fig. 3 and Fig. 4A).

The expression of LinJ06.1320, LinJlO.0380, LinJlO.1450 and LinJ19.0870 was increased

at least fivefold in stationary or late-stationary phase of growth. The extreme example was

LinJ 10.0380 which was increased more than 30-fold in late-stationary phase parasite (Fig.

3). There is no measurable folate uptake in this growth stage (21, 40). Provided that the

RNA levels are correlated to protein levels, which admittedly is not always the case for

95

Leishmania (20, 44), it is unlikely that these FBT members, expressed preferentially in

stationary phase, transport folic acid. This appears to be the case also for LinJ 19.0870 and

LinJ 10.0410, two proteins that localise to the plasma membrane (supplementary Fig. S4).

Leishmania is likely to have a folate mitochondrial pathway (37) and we cannot exclude

that some of these transporters are located in the mitochondria and hence explaining the

absence of accumulation as measured with intact cells. We cannot also exclude that some

of these members correspond to efflux rather than influx proteins.

The expression of FT1 is significantly higher in the logarithmic phase of growth in

Leishmania promastigotes (Fig. 3 and Fig. 4A). Since there is little control at the initiation

of transcription in Leishmania, this growth phase specific increased RNA level must occur

at the post-transcriptional level. Interestingly, the FT1 RNA levels seem also to respond to

folate concentration (Fig. 4A and B). Indeed, the concentration of folate in SDM-79 is

significantly higher than in M-199 (or MAA) and in this folate-rich medium, the FT1 RNA

expression was not higher in exponential phase compared to stationary phase (Fig. 4A). To

test this putative folate effect in more details, we added folic acid directly to the M-199

medium and indeed observed a decrease in FT1 expression (Fig. 4B). This observation has

been repeated many times and is reproducible although it seems slow, i.e. the effect is

measurable after one passage and does not directly relate to folate concentration (Fig. 4B).

The recent discoveries of metabolite sensing ribozymes and riboswitches that cells use to

regulate gene expression in response to changes in metabolite concentration (reviewed in

(45)) may be of relevance here and justify further studies. In an organism devoid of

transcriptional initiation control, several novel mechanisms of gene expression may be

uncovered, as exemplified by the recent demonstration of the involvement of ancient

retroposons in RNA instability (46).

Reduced accumulation of MTX is a frequent mechanism of resistance against this

drug in Leishmania (13, 14, 15). The molecular mechanisms behind this transport defect

were unknown although they seemed to correlate with gene rearrangements (19, 21). The

availability of gene-specific probes and primers has allowed the identification ofthe precise

genetic events leading to the inactivation of FT 1. An homologous recombination between

repeated sequences in LinJ 10.0380 and FT1 occurred in mutant L. infantum MTX 100.1.

96

This recombination led to the deletion ofthe C-terminal part of LinJl0.0380 and the N-

terminal part of FT1 to lead to a novel in frame fusion protein (supplementary Fig. S2).

Extrachromosomal gene amplification events always seem to occur by homologous

recombination between repeated sequences but usually these events are conservative with

no loss of chromosomal copies (42, 43, 47). The rearrangement in mutant MTX100.1 is

non-conservative and leads to a diploid deletion. The only other characterization of a non-

conservative gene deletion event that we are aware of, took place in a mutant resistant to

arsenite where a deletion occurred after homologous recombination between the conserved

nucleotide binding domains of two ABC protein genes (42). However, only one allele was

deleted. Remarkably, cells that are reputed folic acid auxotroph thrive well without an

intact FT1 and without measurable folic acid transport (Fig. 5A). A number of FBT genes

have increased expression in the mutants (Fig. 5B) and some may be involved in the

transport of folate-like molecules. For example, we noted that BTI is overexpressed in both

mutants (Fig. 5B) and it has been shown that small amount of folic acid (but not MTX) can

enter the cell through BTI (16).

The mechanism of inactivation of FT1 in mutant L. infantum MTX1000.3 was

different and involved a segmental gene conversion event with sequences derived from

LinJl0.0410, a transporter that cannot transport folic acid (supplementary Fig. S4). The

unidirectional non-reciprocal transfer of nucleotide from LinJl0.0410 to FT1 fits the

definition of a gene conversion event that was facilitated by the long stretches of identities

between the two genes (Fig. S4). Gene conversion and segmental gene conversion are well

documented in a number of pathogenic microorganisms including the African

trypanosomes (reviewed in (48)) and was recently described in the Leishmania GP63 gene

cluster (49). Leishmania has 14 FBTs and rearrangements, as described here, may further

increase the potential of the FBT repertoire. This may be important to further expand the

capacity to transport molecules related but different than folic acid that may be changing in

the various environments that the parasite encounters. The tandem gene array organization

of FBT genes on chromosome 10 is likely facilitating the selection of the type of

rearrangements described here, although this may matter less for gene conversion events.

97

The design of gene-specific primers has allowed the first molecular explanation for

the inactivation of FT1. Interestingly, this can be mediated by a number of different

mechanisms, some of which had never been described in Leishmania. The availability of

these primers has permitted the characterization of a novel family of proteins found in

bacteria, protozoa and plants. Despite extensive similarities (supplementary Table S2) the

FBT members seem to have different functions. This is consistent with their RNA

expression profiles where several genes are more expressed in growth stages not known to

accumulate significantly folic acid. Further efforts should be devoted to find the

physiological function ofthe remaining FBTs.

Acknowledgements

We thank Jean-Michel Ubeda, Larbi Dridi and Wilfried Moreira for critical reading

ofthe manuscript. This work was funded in part by the CIHR group and operating grants to

M.O. A.A.O. is the recipient of a CIHR studentship. M.O. is a Burroughs Wellcome Fund

Scholar in Molecular Parasitology and holds the Canada Research Chair in Antimicrobial

Resistance.

References

(1) Herwaldt BL. Leishmaniasis. Lancet 1999;354:1191-9. (2) MurrayHW, Berman J, Davies CR, SaraviaNG. Advances in leishmaniasis. Lancet

2005;366:1561-77. (3) Croft SL, Sundar S, Fairlamb AH. Drug resistance in leishmaniasis. Clin

MicrobiolRev 2006; 19:111-26. (4) Ouellette M, Drummelsmith J, Papadopoulou B. Leishmaniasis: drugs in the clinic,

resistance and new developments. Drug Resist Update 2004; 7:257-66. (5) Schweitzer BI, Dicker AP, Bertino JR. Dihydrofolate reductase as a therapeutic

target. FASEB J 1990; 4:2441-52. (6) Nzila A, Ward SA, Marsh K, Sims PF, Hyde JE. Comparative folate metabolism in

humans and malaria parasites. Part I. Pointers for malaria treatment from cancer chemotherapy. Trends Parasitol 2005; 21:292-8.

(7) Hardy LW, Matthews W, Nare B, Beverley SM. Biochemical and genetic tests for inhibitors of Leishmania ptéridine pathways. Exp Parasitol 1997; 87:157-69.

(8) Chowdhury SF, Di Lucrezia R, Guerrero RH, et al.Novel inhibitors of Leishmanial dihydrofolate reductase. Bioorg Med Chem Lett 2001; 11:977-80.

(9) Khabnadideh S, Pez D, Musso A, et al. Design, synthesis and evaluation of 2,4-diaminoquinazolines as inhibitors of trypanosomal and leishmanial dihydrofolate reductase. Bioorg Med Chem 2005; 13:2637-49.

98

(10) Cavazzuti A, Paglietti G, Hunter WN, et al. Discovery of potent ptéridine reductase inhibitors to guide antiparasite drug development. Proc Natl Acad Sci USA 2008; 105:1448-53.

(11) Nare B, Luba J, Hardy LW, Beverley S.Newapproaches to Leishmania chemotherapy: ptéridine reductase 1 (PTRl) as a target and modulator of antifolate sensitivity. Parasitology 1997; 114(Suppl):S101-10.

(12) Ouellette M, Drummelsmith J, El Fadili A, Kundig C, Richard D, Roy G. Pterintransport andmetabolism in Leishmania and related trypanosomatid parasites. Int J Parasitol 2002; 32:385-98.

(13) Ellenberger TE, Beverley SM. Reductions in methotrexate and folate influx in methotrexate-resistant lines of Leishmania major are independent of R or H region amplification. J Biol Chem 1987; 262:13501-6.

(14) Kaur K, Coons T, Emmett K, Ullman B.Methotrexate-resistant Leishmania donovani genetically deficient in the folate—methotrexate transporter. J Biol Chem 1988; 263:7020-8.

(15) Papadopoulou B, Roy G, Ouellette M. Frequent amplification of a short chain dehydrogenase gene as part of circular and linear amplicons in methotrexate resistant Leishmania. Nucleic Acids Res 1993; 21:4305-12.

(16) Kûndig C, Haimeur A, Légaré D, Papadopoulou B, Ouellette M. Increased transport of ptéridines compensates for mutations in the high affinity folate transporter and contributes to methotrexate resistance in the protozoan parasite Leishmania tarentolae. EMBO J 1999; 18:2342-51.

(17) Lemley C, Yan S, Dole VS, et al. The leishmania donovani LD1 locus gene ORFG encodes a biopterin transporter (BTI). Mol Biochem Parasitol 1999; 104:93-105.

(18) El Fadili A, Kundig C, Roy G, Ouellette M. Inactivation ofthe Leishmania tarentolae pterin transporter (BTI) and reductase (PTRl) genes leads to viable parasites with changes in folatemetabolism and hypersensitivity to the antifolate methotrexate. J Biol Chem 2004; 279:18575-82.

(19) Richard D, Kundig C, Ouellette M. A new type of high affinity folic acid transporter in the protozoan parasite Leishmania and deletion of its gene in methotrexate-resistant cells. J Biol Chem 2002; 277:29460-7.

(20) Cunningham ML, Beverley SM. Ptéridine salvage throughout the Leishmania infectious cycle: implications for antifolate chemotherapy. Mol Biochem Parasitol 2001;113:199-213.

(21) Richard D, Leprohon P, Drummelsmith J, OuelletteM. Growth phase regulation of the main folate transporter of Leishmania infantum and its role in methotrexate resistance. J Biol Chem 2004; 279:54494-501.

(22) Wang P, Wang Q, Sims PF, Hyde JE. Characterisation of exogenous folate transport in Plasmodium falciparum. Mol Biochem Parasitol 2007; 154:40-51.

(23) Massimine KM, Doan LT, Atreya CA, et al. Toxoplasma gondii is capable of exogenous folate transport. A likely expansion ofthe BTI family of transmembrane proteins. Mol Biochem Parasitol 2005; 144:44-54.

(24) Klaus SM, Kunji ER, Bozzo GG, et al. Higher plant plastids and cyanobacteria have folate carriers related to those of trypanosomatids. J Biol Chem 2005; 280:38457-63.

(25) Brun R, Schonenberger. Cultivation and in vitro cloning or procyclic culture forms of Trypanosoma brucei in a semi-definedmedium. Short communication. Acta Trop 1979;36:289-92.

99

(26) Sereno D, Lemesre JL. Axenically cultured amastigote forms as an in vitro model for investigation of antileishmanial agents. Antimicrob Agents Chemother 1997; 41:972-6.

(27) Wu Y, El Fakhry Y, Sereno D, Tamar S, Papadopoulou B. A new developmentally regulated gene family in Leishmania amastigotes encoding a homolog of amastin surface proteins. Mol Biochem Parasitol 2000; 110:345-57.

(28) Moore LL, Santrich C, LeBowitz JH. Stage-specific expression of the Leishmania mexicana paraflagellar rod protein PFR-2. Mol Biochem Parasitol 1996; 80:125-35.

(29) Thompson JD, Higgins DG, Gibson TJ. CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice. Nucleic Acids Res 1994; 22:4673-80.

(30) Hall TA. BioEdit: a user-friendly biological sequence alignment editor and analysis program forWindows 95/98/NT. Nucleic Acids Symp Ser 1999; 41:95-8.

(31) Saitou N, Nei M. The neighbor-joining method: a new method for reconstructing phylogenetic trees. Mol Biol Evol 1987; 4:406-25.

(32) Kumar S, Tamura K, Nei M. MEGA3: integrated software for molecular evolutionary genetics analysis and sequence alignment. Brief Bioinform 2004; 5:150-63.

(33) Sambrook J, Fritsch EF, Maniatis T. Molecular cloning. Cold Spring Harbour Laboratory: New York; 1989.

(34) Iovannisci DM, Ullman B. High efficiency plating method for Leishmania promastigotes in semidefined or completely-defined medium. J Parasitol 1983; 69:633-6.

(35) El Fadili A, Kundig C, Ouellette M. Characterization of the folylpolyglutamate synthetase gene and polyglutamylation of folates in the protozoan parasite Leishmania. Mol Biochem Parasitol 2002; 124:63-71.

(36) Papadopoulou B, Roy G, Ouellette M. A novel antifolate resistance gene on the amplified H circle of Leishmania. EMBO J 1992; 11:3601-8.

(37) Gagnon D, Foucher A, Girard I, Ouellette M. Stage specific gene expression and cellular localization of two isoforms of the serine hydroxymethyltransferase in the protozoan parasite Leishmania. Mol Biochem Parasitol 2006; 150:63-71.

(38) Vens AC, Peacock CS, Worthey EA, et al. The genome of the kinetoplastid parasite, Leishmania major. Science 2005; 309:436—42.

(39) Peacock CS, Seeger K, Harris D, et al. Comparative genomic analysis of three Leishmania species that cause diverse human disease. Nat Genet 2007; 39:839—47.

(40) Ellenberger TE, Beverley SM. Biochemistry and regulation of folate and methotrexate transport in Leishmania major. J Biol Chem 1987; 262:10053-8.

(41) Uliana SR, Goyal N, Freymuller E, Smith DF. Leishmania: overexpression and comparative structural analysis of the stage-regulated meta 1 gene. Exp Parasitol 1999;92:183-91.

(42) OuelletteM, HettemaE, Wust D, Fase-Fowler F, Borst P. Direct and invertedDNA repeats associated with P-glycoprotein gene amplification in drug resistant Leishmania. EMBO J 1991; 10:1009-16.

(43) Grondin K, Roy G, Ouellette M. Formation of extrachromosomal circular amplicons with direct or inverted duplications in drug-resistant Leishmania tarentolae. Mol Cell Biol 1996; 16:3587-95.

100

(44) McNicoll F, Drummelsmith J, Muller M, et al. A combined proteomic and transcriptomic approach to the study of stage differentiation in Leishmania infantum. Proteomics 2006; 6:3567-81.

(45) Serganov A, Patel DJ. Ribozymes, riboswitches and beyond: regulation of gene expression without proteins. Nat Rev Genet 2007; 8: 776-90.

(46) Bringaud F, Muller M, Cerqueira GC, et al. Members of a large retroposon family are determinants of post-transcriptional gene expression in Leishmania. PLoS Pathog 2007;3:1291-307.

(47) Beverley SM. Gene amplification in Leishmania. Annu Rev Microbiol 1991; 45:417-44.

(48) Donelson JE. Mechanisms of antigenic variation in Borrelia hermsii and African trypanosomes. J Biol Chem 1995; 270:7783-6.

(49) Mauricio IL, Gaunt MW, Stothard JR, Miles MA. Glycoprotein 63 (gp63) genes show gene conversion and reveal the evolution of OldWorld Leishmania. Int J Parasitol 2007; 37:565-76.

Legend to figures

Fig. 1. Genomic organization of the members of the FBT gene family in L. major and

L. infantum. The FBT genes (open boxes) are organized similarly in both species. The

larger cluster is present on chromosome 10 with 7 tandemly linked FBT genes. The

numbers above and below the boxes correspond to the annotation of each L. major and L.

infantum FBT gene, respectively. Numbers within the box means that both species are

annotated with the same number. Asterisks indicate the duplicated region in the telomeres

of chromosome 10.

Fig. 2. Phylogenetic analysis of the FBT proteins. Amino acid sequences of all 60 FBT

proteins were aligned using the ClustalW algorithm, and evolutionary trees were

constructed using the Neighbor-Joining method with Poisson correction as implemented in

the MEGA3.1 package. The reliabilities of each branch point were assessed by the analysis

of 1000 bootstrap replicates. The vertical bars delimit the representatives of the FBT

proteins of each type of organism. LinJ, L. infantum; LmjF, L. major; Lmex, L. mexicana;

Ltar, L. tarentolae; Tc, T. cruzi; Tb, T. brucei; Tg, T. gondii; At, A. thaliana; Ch, C.

hominis; Cp, C. parvum; PF, P. falciparum.

Fig. 3. FBT gene expression profile in L. infantum according to the growth phases and

life cycles. RNA was isolated from cells grown for 2 days (early-logarithmic), 3 days (mid-

101

logarithmic), 4 days (late-logarithmic), 5 days (stationary) and 6 days (late-stationary). The

expression of genes was measured by TaqMan real-time RT-PCR assays. The relative

expression data were calculated as described under Section 2. Black bars, promastigotes;

white bars, axenic amastigotes. Average of three biological replicates each with two

technical replicates.

Fig. 4. Comparison of the expression levels of target genes FT1, FT5, BTI and

LinJ 10.0380 of L. infantum in different media. (A) Parasites were grown in MAA, M199

or SDM-79 media. The ordinate represents the ratio between mid-logarithmic and

stationary phase. Average of three biological replicates each with two technical replicates.

(B) Effect of folate concentration on FT1 mRNA levels. L. infantum parasites were

incubated in M199 medium or in Ml 99 supplemented with 150 nM and 1.5 pM folate for

four passages. Average of three biological replicates each with two technical replicates. The

biological and technical replicates were further repeated with essentially the same results.

*p < 0.05; **p< 0.01.

Fig. 5. Analysis of L. infantum methotrexate-resistant mutants. (A) Methotrexate and

folate (insert) accumulation in L. infantum wild-type cells ( • ) and L. infantum MTX100.1

(■) and MTX1000.3 (A). (B) Expression profiles of the FBT genes in methotrexate-

resistant mutants L. infantum MTX 100.1 (white bars) and L. infantum MTX 1000.3 (black

bars). The relative expression data were calculated as described in Section 2. Average of

three biological replicates each with two technical replicates. *p < 0.05.

Fig. 6. FBT gene rearrangements in L. infantum methotrexate-resistant mutants. (A)

Southern blot analysis. Total DNAs of L. infantum cells were digested with PstI or Nhel,

transferred to a nylon membrane, and hybridized to a probe recognizing the FBT genes.

Molecular weights shown on the left were determined using the 1-kb ladder (Bio-Rad). (B)

Organization of the FBT genes LinJ10.0370, LinJ10.0380, LinJlO.0390, FT1

(LinJlO.0400) and LinJ10.0410 on chromosome 10 and suggested mechanism for FT1

inactivation. In mutant MTX100.1 (left side), part of FT1 (LinJlO.0400) was deleted by

homologous recombination with sequences present in LinJ10.0380. In mutant MTX1000.3

(right side) a segmental gene conversion event has introduced a fragment of LinJ 10.0410

into FT1. (C) PCR amplification ofthe FT genes LinJlO.0370, LinJ10.0380, LinJlO.0390,

102

FT1 (LinJlO.0400) and LinJlO.0410 using primers 1-12. All fragments were of the

expected size except with primer pair 5-6. Indeed, despite numerous attempts we failed to

find primers specifically amplifying LinJ 10.0390.

04

06

0020 '/■ 4SS kb -

17 kb

95 k b - / , 31 ' / - 375 kb -//■

1260

1320

1 0 " - m m m W ^ W h r ^ r -0350(tv)0360 0370 0380 0385 0390 0400

JrL_jCZ}O^HZ3{MH»v/-1310

0360 0370 0380 0390 0400 0410 0420 Sskb 1450

. . 561 kb 14 « M ff-

571 kb

366 kb

19 ««—// -355 kb

1997 kb

3 5 **>—// -1965 kb

1355

1440

0920

0870

5150 BT1

5120

50 kb -if «*

320 kb ■if * *» '̂ 7< Telomere

t|i pseudogene

79 kb ./j « ,

Figure 1

103

100

100

46r-LmjF10.0385 ^J i -LmjF io .oago

72i—LinJ10.0410

M ] L- LinJl 0.0400-FT1* LinJ 10.0390 LmjF10.0380

UnJ 10.0380 100

u LmjFl 0.0370 r LinJl 0.0370

ioo L LmjFl 0.0360 ■LinJ19.0870

£

32

lLmjF19.0920

77] i LtarFT5* "—l_r-LinJ10.O420

851- LmjFl0.0400

rLinJ06.0310 ioo*LmjF06.0310 99.— LinJ10.0360

100

74 r, LinJ06.1320 LmjF06.1260

LmexBTI* LinJ35.5120 LmjF35.5150

■ LmjFl 0.0350

100 I—

LW04.0020

91

76|-Tl 100 [~t

l—Tc 93

100 rLmjF04.0020 9HLmjF10.0020 sjLmjFIO.ISIO

TcOO. 1047053508027.40 TcOO.1047053506633.90

Tc00.1047053511575.130 Tb927.8.3620

TD927.8.3630

Leishmania

100 S? 96L

80 100

99! Tb927.8.3650 -Tb10.6k15.1350

rTb927.1.2850 ^ À Tb927.1.2820

571-^927.1.2880 -Tg55.m04868

Tg20.m03988 Tg42.m03408

99, At5g25040 I At5g2505O

At1g79710 At5g 10820

100

Trypanosoma

99 r— At2g33280

— At1g04570 -At1g64890

26

44

76

.At5g54860 MAL8P1.13

PF110172 Ch.EAL37224

^-Cp-CAD98492

99 50

02 100

100" -At2g32040 — Syne<*ocystis-slr0642

Nostoc Syn43cho<XMXus-ABB56229

i— Synecho<x)ccus-ABD02128 t - Synechococcus-ABD00754

Toxoplasma gondi i

Arabidopsis thaliana

Plasmodium falciparum

Cryptosporidium

Cyanobacteria

Figure 2

104

uoissajdxa 3AijE|9y

So -

105

2

ci) o

c o « £ S3. X OJ

>

ce

MAA M199 SDM

Medium

Figure 4

106

1 o E Q. C o

E

K! (U C

I

B

> (fl c

E

U) 2 a x a> > ra a> or

Time (min)

MTX1000.3 MTX100.1

«*' # # A0' A* A° c r cr ^ cr C>* <T

0 0 kO n 0 çû -lO oû x \ . 0 ,<*> «û A 0 ^ \

\> V

* 0 ' * * cr cr

Figure 5

107

B WT / / 0370

X/MTX100.1 NN.MTX1000 .3

S-Tt *•* 0400 0410 0400 0410

, i 7 8

11 -»•♦■ 12 V

0400 0410 [—//

/ / — 0370 0380/0400 0410 / /

s i s i 5 5 5 5

i ï S kb 5 ï S kb 12 M H i ^ H 12

Primer pairs 1-2 3A S-6 7-8 11-12 9-10 3-12 UnJ10. 0370 0380 0300 0400 0400 (WfO 0380/0400

Figure 6

108

Supplemental Tables and Figures

Figure SI. Relative expression levels of control genes. A, Expression of PFR2 and

Amastin genes in promastigotes vs amastigotes. B. Expression of PTRl and META1 genes

in mid-logarithmic phase vs stationary phase of the promastigote stage. The relative

expression data were calculated as described under Material and Methods. Average of three

biological replicates each with 2 technical replicates. *, p<0.05; **, p< 0.01.

B

E < o

a. x cu

PFR2 Amastin PTR1 META1

Figure S2. Sequence ofthe L. infantum chimera gene LinJl 0.0380/0400. The amplified fragment derived from L. infantum MTX 100.1 obtained using primer 3 and 12 (which are underlined) was sequenced. The coding sequence (starting from the ATG) of LinJ 10.03 80 is shaded in gray, the conserved sequence of 80 nucleotides between LinJl0.0380 and LinJl0.400 is not shaded and the sequence of LinJ 10.0400 (FT1) (until the stop codon) is shaded in black. The resulting protein is shown below with the same color code. The sequence of the chimera gene is available under accession number EU221004.

TCACGGTGATCGGAGCTTCTCGCTGCGCATTGCGCCCGCGCA GACACGCTCACAAAACCAAGCGCGC CATGAGCCCTCCCACGACGCCGGGAAGGCGCAGAACAGCGCGCAAGGGTCGCAAGTGACGCAGAAATACTACG TCCATCCGCAGGCAGCCGCCTTGTTCTCTAAGTGGCCGTGGGTGCGACGGGTGCCGATATTTGGTGAGGCTG1 CGAGGGCTACGGGCCCAAGGTCATCGTCGCTCTTGGTACGAGCTACCTGCTCTGCAAGGGCGTCGCGGATCAC ATTCTTACCGGTCAGACGTACGCCATGATGATTGATCGCTACGGCATCAGTGTTCCCCGCTACCAGCGCCTGT CTCCGATTTCGTCCATGGGGTGGTCCATCAAGGCCTTCACAGCGATGCTCTGCGACGGCTTCGCCTTCCTCGG CTACACGAAGCGCTGGTACATGTTCATCTCCTGCGTCGGCGGTGGCGCGTTCGCGCTGATCTACGGCCTCCT1 CCGGCGAAGGAGGCGTCGGCTGATGTGGCAGCCGCCTTCATCTTCCTGTCGACGTGGGGCAAGGCCAACGTGG ATATCCTGTCGGAGGGCCATTACAGTCGACTGATGCGCCAGAACCCGAAGCCTGGCCCGTCCATGGTGAGCTG

109 GATCTGGTTCTGGATCATGGTAGGGGCCATCATCGCGACTGTGATGAACGGCCCGCTCGCGGATGCCGGGAAG CCGCAGATCAGCATCTTCGTGTCTGCCGCGCTGCAG

CGCTGTGGAGTGCTGTGCGAAG TATTGTGGCGCTTGACGGTTGTTGAAAGGGA

MTRSQNQARTHEPSHDAGKAQNSAQGSQVTQKYYVHPQAAALFSKWPWVRRVPIFGEAVEGYGPKVIVALGTS YLLCKGVADQILTGQT YAMMIDRYGISVPRYQRLS PISSMGWSIKAFTAMLCDGFAFLGYTKRWYMFISCVGG GAFALIYGLLPAKEASADVAAAFIFLSTWGKAMVDILSEGHYSRLMRQNPKPGPSMVSWIWFWIMVGAIIATV MNGPLADAGKPQISIFVSAALQH

Figure S3. Segmental gene conversion in FT1 (LinJl0.0400). The amplified fragment

derived from L. infantum MTX 1000.3 obtained using primers 11 and 12 (which are

underlined and at each end) was sequenced and compared to the FT1 and LinJl 0.0410

sequences. Sequences identical to the mosaic FT1 gene found in L. infantum MTX 1000.3

are shaded in gray. Sequences are identical to FT1 for the first 326 nucleotides (#).

Afterwards, there is complete identity for the next 591 nucleotides between FT1, the

mosaic gene and LinJl 0.0410 (first cross-over region); then the sequence ofthe mosaic

gene is identical to LinJl 0.0410 for 385 nucleotides (#); then there is complete identity

between FT1, the mosaic gene and LinJlO.0410 for 185 nucleotide (second cross-over

region) (#); then the sequence is identical to FT1(#). Primers 7 and 8 (which are

underlined) that are used for the TaqMan PCR assay for FT1 are within the mosaic

110

explaining the absence of amplification of FT 1 in L. infantum MTX 1000.3. The sequence

ofthe mosaic gene is available under accession number EU221005.

FT1-WT AGCTGGATGTGGTTTTGCATAATGATTGGCTCACTCATCGCGACTGTGATGAACGGCCCG FT1-MTX1000.3 AGCTGGATGTGGTTTTGCATAATGATTGGCTCACTCATCGCGACTGTGATGAACGGCCCG LinJl0.0410 AGCTGGATCTGGTTCTGGATCATGACCGGCTCACTCATCGCGACTGTGATGAACGGCCCG

******** ***** ** ** **** *********************************

FT1-WT CTCGCGGATGCCGGGAAGCCGCAGATCAGCATCTTCGTGTCTGCCGCGCTGCAGGCCATC

LinJlO.0410 CTCGCGGATGCCGGGAAGCCGCAGATCAGCATCTTCGTGTCTGCCGCGCTGCAGGCCATC ************************************************************

FT1-WT ACCTGCGTCTTCTACCTGTTCAACTGGTACGGGGAGAAGAAGAACCGCGTGCTGCGTTCC FT1-MTX1000.3 ACCTGCGTCTTCTACCTGTTCAACTGGTACGGGGAGAAGAAGAACCGCGTGCTGCGTTCC LinJl0.0410 ACCTGCGTCTTCTACCTGTTCAACTGGTACGGGGAGAAGAAGAACCGCGTGCTGCGTTCC

************************************************************

FT1-WT FT1-MTX1000.3 LinJlO.0410 GAGGACGCGCTGTTTATTCTGGAGGAGACGCGCAAGGAGCGTGAGCGCCTGGGCCTCGAG

************************************************************

FT1-WT GGGGTGAACAACGGCACGGCGGGTGCGCAGCATGGT FT1-MTX1000.3 LinJl0.0410 GGGGTGAACAACGGCACGGCGGGTGCGCAGCATGGTGGTGCGGCGAAGGGGAAGAGGAGC

************************************************************ ♦

FT1-WT CCGCAGCGCTCGCACTCGGATGAGGACGTGGAGGGTGCCGTACGGGATGCCCTCAACGAT FT1-MTX1000.3 CCGCAGCGCTCGCACTCGGATGAGGACGTGGAGGGTGCCGTACGGGATGCCCTCAACGAT LinJl0.0410 CCGCAGCGCTCGCACTCGGATGAAGGCGTGGAGGGTGCCGTACGGGATGCCCTCAACGAT

*********************** * **********************************

FT1-WT GGTCAGCGCGACAACGGTGAACffGTGCÀGGÀCGTCTACGACGÀCGCGTATGACGACGGQ FT1-MTX1000.3 GGTCAGCGCGACAACGGTGAACTTGTGCAGGACGTCTACGACGACGCGTATGACGACGGO LinJl0.0410 GGTCAGCGCGACAACGGTGAACTTGTGCAGGACGTCTACGACGACGCGTATGACGACGGC

************************************************************

FT1-WT GAAGAGGTGGCCGAGGGCGAGGTGTACTACGGCAAGCCGCCGGTGCCGTGCCTGTTCGGG FT1-MTX1000.3 GAAGAGGTGGCCGAGGGCGAGGTGTACTACGGCAAGCCGCCGG LinJl0.0410 GAAGAGGTGGCCGAGGGCGAGGTGTACTACGGCAAGCCGCCC

**********************************************************

FT1-WT CTGTTCGAGGCGAACACGGAGGTGATTTCGAAGAACTGGAAGATCTTCGTGTACAGCGTT FT1-MTX1000.3 CTGTTCGAGGCGAACACGGAGGTGATTTCGAAGAACTGGAAGATCTTCGTGTACAGCGTT LinJl0.0410 CTGTTCGAGGCGAACACGGAGGTGATTTCGAAGAACTGGAAGATCTTCGTGTACAGCGTT

************************************************************

FT1-WT GTCATGACCTGTGCTGTGATCGCGATGCTGTGTGCCÂÀCATCCTGGCCGACACGCTGGGC FT1-MTX1000.3 GTCATGACCTGTGCTGTGATCGCGATGCTGTGTGCCAACATCCTGGCCGACACGCTGGGC LinJl0.0 410 GTCATGACCTGTGCTGTGATCGCGATGCTGTGTGCCAACATCCTGGCCGACACGCTGGGC

************************************************************

FT1-WT CTCCTGGTTGCGTGCGTCGTTGTGTCGACCATCTGCTGCGCCGCGTCCl FT1-MTX1000.3 CTCCTGGTTGCGTGCGTCGTTGTGTCGACCATCTGCTGCGCCGCGTCCTTCTGi LinJl0.0410 CTCCTGGTTGCGTGCGTCGTTGTGTCGACCATCTGCTGCGCCGCGTCCTTCTGGGCCCTG

************************************************************

FT1-WT CCGCTGGTGATTGCGAAGGCCAACGTGTTTGCATACCTGGATAAGGCTGTTTCCÂTCCGT FT1-MTX10 00.3 CCGCTGGTGATTGCGAAGGCCAAeGTGTTTGCATACCTGGATAAGGCTGTTTCCATCCGT LinJ10.0410 CCGCTGGTGATTGCGAAGGCCAACGTGTTTGCATACCTGGATAAGGCTGTTTCCATCCGT

************************************************************

FT1-WT FT1-MTX1000.3 LinJlO.0410

111

GTGAGCGGTCCCCTAAACGCGTTCTACTTGAACACCTACGGCTGCCCCGGCAACCTGCCG GTGAGCGGTCCCCTAAACGCGTTCTACTTGAACACCTACGGCTGCCCCGGCAACCTGCCC GTGAGCGGTCCCCTAAACGCGTTCTACTTGAACACCTACGGCTGCCCCGGCAACCTGCCC *************

FT1-WT FT1-MTX1000.3 LinJlO.0410

AACTTCACCTACACCTTCTACAACACGGTGGCTGGCGTCATCAACACTATCGTTGGTATG AACTTCACCTACACCTTCTACAACACGGTGGCTGGCGTCATCAACACTATCGTTGGTATG AACTTCACCTACACCTTCTACAACACGGTGGCTGGCGTCATCAACACTATCGTTGGTATG ************************************************************

FT1-WT FT1-MTX1000.3 LinJlO.0410

FT1-WT FT1-MTX1000.3 LinJlO.0410

ATTACCGTGACGCTGTTCAACTTCCTGTTCGCGAAGCATGGCTACCGCCTCACCTTCATT ATTACCGTGACGCTGTTCAACTTCCTGTTCGCGAAGCATGGCTACCGCCTCACCTTCATT ATTACCGTGACGCTGTTCAACTTCCTGTTCGCGAAGCATGGCTACCGCCTCACCTTCAT'I! ************************************************************

# GTGACGACAATCATGCAAGTTCTGGCAGCGCTGTTCGACATCATCATTGTGAAGCGCTGG GTGACGACAATCATGCAGG1 GTGACGACAATCATGCAGGTTATGGGTGG ***************** *** *** * **************** ************

FT1-WT FT1-MTX1000.3 LinJlO.0410

FT1-WT FT1-MTX1000.3 LinJlO.0410

AACCTGTACATCGGCATCCCTGACCACGCCATGTACATCTGGGGTGATGCTGTTGTGGGT AACCTGTACATCGGCATCCC ******************************************** ** ***********

7 GAGATCGTGTACATGCTTGGCTTTATGCCGCAGATCGTGCTGCTGTCTCGCCTGTGCCCT GAGCTCGTGTACATGCTCGCCCTTATGCGGCCTGTGGTGCTGCTGTCTCGCCTGTGCCCT GAGCTCGTGTACATGCTCGCCCTTATGCCGCCTGTGGTGCTGCTGTCTCGCCTGTGCCCT

********** :*+***

FT1-WT FT1-MTX1000.3 LinJlO.0410

CGTGGCTCGGAGAGTGTCGTGTATGCGCTGATGGCGGGCTTCGCCCGCCTTGGCCGAACC CGTGGCTCGGAGAGTGTCGTGTATGCGCTGATGGCGGGCTTCGCGAGCCTTGGCCAGACC CGTGGCTCGGAGAGTGTCGTGTATGCGCTGATGGCGGGCTTCGCGAGCCTTGGCCAGACC ******************************************** ********* ***

FT1-WT FT1-MTX1000.3 LinJlO.0410

ACCGCGGCGTCTCTCGGTGCCATCCTTCTGGAGTACGGCCTGCCTGTGTTCAAGACGCAG ACCGCGGCGTCTCTC ^ATCCTTCTGGAGTAC ACCGCGGCGTCTCTCGGTGCCATCCTTCTGGAGTACGGCCTGCCTGTGTTCAAGACGCAG ************************************************************

FT1-WT FT1-MTX1000.3 LinJlO.0410

GATGACGGGTCTCGCTGCAACTACGACAACCTGCCGCTGCTGCTGTTCCTGTGCAGCATG

GATGACGGGTCTCGCTGCAACTACGACAACCTGCCGCTGCTGCTGTTCCTGTGCAACATG ******************************************************* ****

FT1-WT FT1-MTX1000.3 LinJlO.0410

TGCACGCCGCTGCTGGCGATTCCGCTGAGCATAATACTGCTTCCGAAGGCGCGCATCTGC

************** r***********J

FT1-WT FT1-MTX1000.3 LinJlO.0410

GACGATATCGACATTGACGGCAAGGTGGTGCGTCAGGCCGTGGATAAGCAGGTCGCAGC1| GACGATATCGACATTGACGGCAAGGTGGTGCGTCAGGCCGTGGATAAGCAGGTCGCAGCT GAC VTCGACM GGCCC ÎATC ************************************************************

FT1-WT FT1-MTX1000.3 LinJlO.0410

GCTCCGCTGCCGAGCTCCGACTCGGACGCGGTGATGAATGCCGAACCGCTTCATGGGAAC GCTCCGCTGCCGAGCTCCGACTCGGACGCGGTGATGAATGCCGAACCGCTTeATGGGAAC GCTCCGCTGCCGAGCTCCGACTCGGACGCGGTGATGAATGCCGAACCGCTTCATGGGAAC ************************************************************

FT1-WT FT1-MTX1000.3 LinJlO.0410

AAGGCGGATGAGCGCGAGGCAGCGCGCGGGGAGGCGGTGCAGGGCAA-ACG GGCGGG AAGGCGGATGAGCGCGAGGCAGCGCGCGGGGAGGCGGTGCAGGGCAA-ACG GGCGGG AAGGCGGATGAGCGCGAGGCAGCGCGCGGGGAGGCGGTGCAGGGCAAC GCG|TGAtAGCAGA *********************************************** ** ** *

112

FTl-WT FT1-MTX1000.3 LinJlO.0410

CGCTTCAÇ^GAAAfrAqCTGGCGCTGTGGA-GTGCTGTGCGAAGTATTGTGGCGCTTGACG CGCTTClAGAGAAAfrÂqCTGGCGCTGTGGA-GTGCTGTGCGAAGTATTGTGGCGCTTGACG AGCCGTGCGCAGGTAGCGGGGGCGGCGCATGTGCTGTAACCCGTGTGTTCACGGCTGCC-** * **** ** ** * * * ******* ** * * ** ** *

FTl-WT FT1-MTX1000.3 LinJlO.0410

GTTGTTGAAAGGGA GTTGTTGAAAGGGA -TCGCAGCACG * * * * *

Figure S4. Cellular localisation and functional analysis of LinJlO.0410 and

LinJ19.0870. The LinJl0.0410 and LinJl9.0870 genes were fused to the green fluorescent

protein and cloned into Leishmania expression vectors. A. The fusion proteins are located

to the plasma membrane as determined by immunofluorescence microscopy. B. Transport

of folic acid in L. tarentolae wild-type cells (•); in the mutant MTX 1000.6 with no

transport activity (■); in the MTX1000.6mutant transfected with FT1 (□); LinJlO.0410 (o)

and with LinJl9.0870 (A). The same results were obtained with the two FBT genes

unfused to GFP.

LinJ 10.0410-GFP LinJ19.0870-GFP

B

o

o E a. c o

u u <0

4 6 Time (min)

10

# TarWT

■ MTX 1000,6

O MTX1000.6 pSPoNEO.t-LinJ10.0410.GFP

▲ MTX1000.6pSP(tNEOu-LinJ19.0870-GFP

□ MTX1000.6pSPaHYGa-IT1-GFP

113

Table SI. Forward (FW) and reverse (RV) real-time primers and TaqMan probes (TP)

sequences for FBT transporters and other genes ofL. infantum.

Systematic Name' Products Sequence (5'=>3') Amplicon

length (bp)

LinJ04.0020 Ptéridine transporter FW AGGCCAACATCTTCGGATGGTG

159 LinJ04.0020 Ptéridine transporter RV TGGCAGCGTTGCCAATGACA 159 LinJ04.0020 Ptéridine transporter TP1 TGTCCTACATCCTCATCTCCGGCG

159

LinJ06.0310 Ptéridine transporter FW CTACTACCTCGCCTGGATGCCAAC

105 LinJ06.0310 Ptéridine transporter RV CCCAGGTTGCCGAAGCCG 105 LinJ06.0310 Ptéridine transporter TP2 CAGCGCGTACACCATGCTCTC

105

LinJ06.1320 Ptéridine transporter FW CGCGATTGTGTACGAAATCTGCTTTG

135 LinJ06.1320 Ptéridine transporter RV ATCGAATTGCCGGCGCTGTT 135 LinJ06.1320 Ptéridine transporter TP4 TGATGCCGGGGCAGATCCTCATGT

135

LinJ 10.0360 Ptéridine transporter FW CATGCTTAGCACCATGCCGTG

112 LinJ 10.0360 Ptéridine transporter RV CACGGTCTGGCCAAAGTTGGAT 112 LinJ 10.0360 Ptéridine transporter TP3 CCTGTGCCCTCGTGGCTCGGAGA

112

LinJ 10.0370 Ptéridine transporter FW ATGTACATCTGGGGTGCG

161 LinJ 10.0370 Ptéridine transporter RV GACGCGGAAGTCGAGC 161 LinJ 10.0370 Ptéridine transporter TP3 CCTGTGCCCTCGTGGCTCGGAGA

161

LinJ 10.0380 Ptéridine transporter FW TGGGGTGATGCGGTTGTAGC

179 LinJ 10.0380 Ptéridine transporter RV CCGTACTCCATGATGATCGCAG 179 LinJ 10.0380 Ptéridine transporter TP3 CCTGTGCCCTCGTGGCTCGGAGA

179

LinJ 10.0400 FT1; Folate/methotrexate transporter

FW TACATGCTTGGCTTTATGCCGCA 123 LinJ 10.0400

FT1; Folate/methotrexate transporter

RV AGACGCCGCGGTGGTTC 123 LinJ 10.0400 FT1; Folate/methotrexate transporter TP3 CCTGTGCCCTCGTGGCTCGGAGA

123

LinJlO.0410 Ptéridine transporter FW CTCGCCCTTATGCCGCCT

109 LinJlO.0410 Ptéridine transporter RV CGGTGGTCTGGCCAAGGCTC 109 LinJlO.0410 Ptéridine transporter TP3 CCTGTGCCCTCGTGGCTCGGAGA

109

LinJl 0.0420 FT5; folate/methotrexate transporter

FW TTTGCGGTGATGCTGTTGTGTATC 205 LinJl 0.0420

FT5; folate/methotrexate transporter

RV GGGGGTGTGGTGGTGATGCT 205 LinJl 0.0420 FT5; folate/methotrexate transporter TP3 CCTGTGCCCTCGTGGCTCGGAGA

205

LinJlO.1450 Ptéridine transporter FW CGATCATGAAGGCCAACT

144 LinJlO.1450 Ptéridine transporter RV CGACAGTGTTGTAGAATGTCTGA 144 LinJlO.1450 Ptéridine transporter TP1 TGTCCTACATCCTCATCTCCGGCG

144

LinJ19.0870 Ptéridine transporter FW TGTGTTTCAGGTGTGCTACTAT

130 LinJ19.0870 Ptéridine transporter RV CATCGTCTCTCCGAGGTTGGCA 130 LinJ19.0870 Ptéridine transporter TP2 CAGCGCGTACACCATGCTCTC

130

LinJ35.5120 BTI; biopterin transporter

FW GCAATCATCTACGAAGTGTGCGAT 174 LinJ35.5120 BTI; biopterin

transporter RV CCAAATCGTTTCCATCAGCAGGT 174 LinJ35.5120 BTI; biopterin transporter

TP5 CCTGAACATGCCCATGATGATGCTC 174

GAPDH Glyceraldehyde-3-phosphate dehydrogenase

FW AAGGAGAACTTCGGCATCGAGACTG 255 GAPDH

Glyceraldehyde-3-phosphate dehydrogenase

RV CGCGCGGAACGTCAGGTC 255 GAPDH Glyceraldehyde-3-phosphate dehydrogenase TP6 TGACCACCATCCACTCCTACACGGCGA

255

LinJ04.1250 Actin FW GCTGTACGGGAACATCGTGCTG 118 LinJ04.1250 Actin RV CGCAACCACCTTCGGCTTTATC 118

LinJ23.0310 PTRl FW CTGTTACCCTCTTCAAGCGC 156 LinJ23.0310 PTRl RV CCCTATCTCCGACACAGGGC 156

LinJ 17.0990 META1 FW GGTGTGACGGTGGAGTTCAAGG 150 LinJ 17.0990 META1 RV GTCGTCGCTGCCCAACATCATC 150

LinJ16.1510 PRF2C FW GAGATCCGCGACGTTGCTATTG 156 LinJ16.1510 PRF2C RV CCGGTCGAAGCTCTTGTTCTCG 156

LinJ34.1020 Amastin FW GATGACACCGAGGGCATGTACG 169 LinJ34.1020 Amastin RV CAACAGAGAGGATGGCAAACGC 169 1 The L. infantum annotations are derived from GeneDB version 3 (www.genedb.org). FW, forward primer; RV, reverse primer; TP, TaqMan probe dual-labeled with 5'FAM /3'BHQ for the FBT genes and 5'TET /3'BHQ for GAPDH. Note that some Taqman probes were useful for more than one target.

114

Chapitre III. Le transporteur de la £-adénos\ Iméthionine de haute affinité localisé au niveau de la membrane plasmique du parasite Leishmania est un membre de la famille des transporteurs de folate et de la bioptérine (FBT)

Le contenu de ce chapitre a fait l'objet d'une publication dans la revue Journal of Biological Chemistry (2010) 285(26): 19767-75

3.1 Résumé

S-Adénosylméthionine (AdoMet) est un donneur du groupement méthyl et joue un

rôle central dans divers processus biochimiques essentiels. Le parasite Leishmania peut à la

fois synthétiser et transporter l'AdoMet. Certaines cellules de Leishmania résistantes à

l'antifolate methotrexate (MTX), dû à un rearrangement au niveau des gènes de la famille

des transporteurs de folate et de la bioptérine (FBT), montrent une résistance croisée à la

sinéfungine (SNF), un analogue structural d'AdoMet. Nous avons également observé un

réarrangement dans les gènes FBT chez des cellules de Leishmania major sélectionnées

pour la résistance à la SNF. Un des gènes FBT réarrangé correspondait au principal

transporteur d'AdoMet de Leishmania et a été nommé AdoMetTl. La fonction

d'AdoMetTl a été déterminée par des expériences de transfection et d'inactivation génique.

AdoMetTl possède une haute affinité pour l'AdoMet, il est localisé au niveau de la

membrane plasmique et est constitutivement exprimé au cours des différentes phases de

croissance du parasite. Nous avons montré que les cellules de Leishmania sélectionnées

pour la résistance ou naturellement insensibles à la SNF avaient une faible expression du

gène AdoMetTl. En conclusion, une nouvelle fonction dans le métabolisme monocarboné,

une voie métabolique au potentiel thérapeutique, est décrite pour cette nouvelle classe de

protéines membranaires retrouvées dans divers organismes.

115

3.2 Article

The high affinity 5-adenosylmethionine plasma membrane transporter of Leishmania

is a member of the folate biopterin transporter (FBT) family.

Larbi Dridi1'2, Amin Ahmed Ouameur1,2 and Marc Ouellette1'*

From the Centre de Recherche en Infectiologie du CHUL, Université Laval, Québec, Canada.

2These authors contributed equally to this work.

* Corresponding author : Marc Ouellette Ph.D. Centre de Recherche en Infectiologie du CHUL 2705, Boul. Laurier Québec, Québec G1V4G2 Tel: 1-418-654-2705 Fax: 1-418-654-2715 E-mail : Marc.Ouellette@crchul.ulaval.ca

Running head: S-adenosylmethionine transporter of Leishmania

Keywords: Leishmania, FBT family, S-adenosylmethionine, sinefungin, folic acid,

methotrexate, plasma membrane protein.

116

Abstract

S-Adenosylmethionine (AdoMet) is an important methyl group donor that plays a

central role in many essential biochemical processes. The parasite Leishmania can both

synthesize and transport AdoMet. Leishmania cells resistant to the antifolate methotrexate

due to a rearrangement in folate biopterin transporter (FBT) genes were cross-resistant to

sinefungin, an AdoMet analogue. FBT gene rearrangements were also observed in

Leishmania major cells selected for sinefungin resistance. One ofthe rearranged FBT genes

corresponded to the main AdoMet transporter (AdoMetTl) of Leishmania as determined by

gene transfection and gene inactivation experiments. AdoMetTl was determined to be a

high affinity plasma membrane transporter expressed constitutively throughout the growth

phases of the parasite. Leishmania cells selected for resistance or naturally insensitive to

sinefungin had lower expression of AdoMetTl. A new function in one carbon metabolism,

also a pathway of interest for chemotherapeutic interventions, is described for a novel class

of membrane proteins found in diverse organisms.

117

Introduction

The parasite Leishmania is distributed globally and causes a variety of clinical

symptoms ranging from self-healing cutaneous lesions to visceral infections that are usually

fatal if left untreated (1,2). Current first-line chemotherapy against leishmaniasis relies on

a rather limited arsenal of drugs, including pentavalent antimonials, liposomal amphotericin

B, or miltefosine (2). These drugs are associated with side effects, high costs, and drug

resistance, and therefore, the search for new drugs and targets to control this parasite is

warranted (3, 4).

5-Adenosylmethionine (AdoMet or SAM) is an important biological sulfonium

compound recognized as the universal methyl donor for methylation of lipids, proteins,

nucleic acids, and xenobiotics in living cells (5). AdoMet is also a donor of propylamine

groups for the synthesis of polyamines and participates in the reverse trans-sulfuration

pathway where AdoMet is converted into cysteine and glutathione and in Leishmania in the

spermidine-glutathione conjugate trypanothione (6, 7). AdoMet is also used as a source of

methylene groups, amino groups, and ribosyl groups in the synthesis of fatty acids, biotin,

and the modified nucleoside epoxyqueusine of tRNAs (reviewed in Ref. 8).

Most cells are capable of synthesizing AdoMet from L-methionine and ATP, in a

process requiring the enzyme methionine adénosyltransférase (MAT). The gene coding for

this enzyme is present in most sequenced organisms (reviewed in Ref. 9). However, in

some Rickettsia strains, the MA T gene is inactivated by a mutation (10), and in the fungus

Pneumocystis carinii, no MAT activity has been detected (11). These organisms have the

rare distinction of meeting their AdoMet needs by importing it (12). The Rickettsia

transporter is part ofthe drug/metabolite transporter superfamily (10), and the identity of

the Pneumocystis transporter is not known. Transport of AdoMet across the plasma

membrane does not occur to a significant extent in mammalian cells, but transport of

AdoMet is essential in several organelles. For example, the yeast (13) and human (14)

mitochondrial AdoMet transporters and the Arabidopsis AdoMet plastid (and

mitochondria) transporter (15, 16) have been functionally characterized. They belong to the

118

mitochondrial carrier protein family (MCF), a class of protein mediating the transport of

various substrates (reviewed in Ref. 17).

Other organisms, notably fungus and protozoa, have the ability to both synthesize

and transport AdoMet. The only eukaryotic plasma membrane AdoMet transporter

characterized to date is the Saccharomyces cerevisiae SAM3 protein (18) belonging to the

amino acid permease superfamily. Although SAM3 transports AdoMet, it also transports

polyamines with high affinity (19). Sinefungin (SNF) is an analogue of AdoMet with

antimicrobial activity, and yeast SNF-resistant mutants were shown to have loss-of function

mutations in SAM3 (20). In the protozoan parasites Leishmania (21) and Trypanosoma

brucei (22), SNF and AdoMet were shown, on the basis of substrate competition transport

experiments, to share a common transporter protein. We report here the cloning and

functional characterization of the unique high affinity AdoMet transporter of Leishmania

and show that it belongs to the FBT family, a class of proteins present in diverse organisms.

Materials and Methods

Cell Lines and Culture Conditions

Leishmania cells (Leishmania infantum MHOM/MA/67/ITMAP-263, L. infantum

JPCM5, Leishmania tarentolae, Leishmania major Friedlin, and L. major LV39) were

grown in SDM-79 medium supplemented with 10% heat-inactivated fetal bovine serum, 5

pg/ml hemin, and, when required, 10 pM biopterin (Sigma). The L. tarentolae

methotrexate (MTX)-resistant mutant TarMTXl 000.6 was described previously (23). The

L. tarentolae and L. major LV39 SNF-resistant mutants, named TarSNF.8 and

LV39SNF4000.4, respectively, were selected with SNF in a step-by-step manner as

described in details for other drugs (24). Cell growth was monitored by measuring the

absorbance of culture aliquots at 600 nm in a multiwell scanning spectrophotometer. DNA

transfection into Leishmania promastigotes has been performed as described previously

(25).

119

AdoMetTl Gene Transfection and Inactivation

The AdoMetTl gene of Z,. infantum (LinJ 10.0370) was amplified from genomic

DNA using primer pairs 1-2 and 3^4 (see supplemental Table SI). The PCR fragment was

first ligated into the pGEM T-easy vector (Invitrogen), digested with the appropriate

restriction enzymes, and cloned into the relevant restriction sites within the Leishmania

expression vectors pSP72 ocHYGa (26) and pSPaNEOa-GFP (27). The L. infantum

AdoMetTl null mutant was obtained by targeted gene replacement. The AdoMetTl

inactivation cassettes were generated using a PCR fusion-based strategy as described

previously (28). Primers used to generate the inactivation cassettes are listed in

supplemental Table SI. Briefly, the NEO inactivation cassette was generated by using the

primer pairs 5-6 and 7-8 to amplify DNA fragments of 730 bp upstream and 680 bp

downstream of the AdoMetTl gene, respectively. The neomycin phosphotransferase (NEO)

gene was amplified from the plasmid pSPccNEOa using primers 9 and 10 and then fused to

the upstream and downstream DNA fragments of AdoMetTl using PCR. The same strategy

was used to generate the ZEO cassette; primer pairs 5-11 and 12-8 were used to amplify

the upstream and downstream fragments of AdoMetTl, whereas primers 13 and 14 were

used to amplify the ZEO gene from the pSPaZEOa vector (29).

Cellular Transport Assays

TarMTXl000.6 expressing the AdoMet transporter (AdoMetTl) and the folic acid Q

transporter (FT1) were harvested during the mid-logarithmic phase. 10 cells were washed

and resuspended in folate deficient medium fdDMEL or AdoMet-deficient medium with

115 nM [3H]folic acid (43.2 Ci/mmol) or 60 nM [3H]AdoMet (83 Ci/mmol) (Moravek

Biochemicals), respectively. Accumulation was measured as described previously (30).

Folic acid uptake was normalized to cell number, and the background transport value was

removed by subtracting the accumulation value obtained on ice. The transport kinetic

parameters Vmax and apparent Km values for AdoMet were measured while using different

[3H]AdoMet concentrations (3-3000 nM) during the linear phase of accumulation (5 min).

Transport kinetic parameters were determined by linear regression analysis and Michaelis-

Menten analysis. The transport competition study was performed with 5 x 10

LV39SNF4000.4 cells expressing the AdoMetTl-GFP protein. Briefly, cells were

120

incubated for 10 min in an assay buffer, as described previously (31 ), containing 50 nM

radioactive AdoMet in the presence or absence of various concentrations (100 nM and 1

and 10 pM) of competing molecules. For all transport experiments, the accumulation in

cells incubated on ice was subtracted.

Quantitative Real Time Reverse Transcription-PCR

Three independent RNA preparations were used for each real time PCR experiment.

RNA extractions, cDNA synthesis, and TaqMan quantification of AdoMetTl were

performed as described previously (27). Primers and Taxman probes are listed in

supplemental Table S2. Real time reverse transcription- PCR for the MAT gene was

performed as described previously (32) using GAPDH and actin genes as controls

(supplemental Table S2).

Western Blot Analysis

Total Leishmania proteins (30 pg) were run on 12% polyacrylamide gels and

transferred onto nitrocellulose membranes as described previously (33). The blots were

blocked overnight in 5% skimmed milk in IX phosphate- buffered saline (PBS). A

monoclonal anti-a-tubulin antibody (Sigma) directed against a conserved amino-terminal

peptide of the bovine ct-tubulin or an antibody against the green fluorescent protein (GFP)

(Invitrogen) was diluted 1:3000 in PBS containing 0.1% Tween 20 (PBS/Tween) and

incubated for 1 h with the membranes. The blots were washed three times for 5 min in

PBS/Tween and incubated with horseradish peroxidase- conjugated sheep anti-rabbit IgG

for GFP or sheep anti-mouse IgG for ct-tubulin (Amersham Biosciences) diluted 1:10,000

in PBS/Tween. The blots were washed as above, incubated with ECL Plus

chemiluminescent substrate (Amersham Biosciences), and exposed to x-ray films. The

polyclonal rabbit MAT antibody was kindly provided by Prof. Balana-Fouce (University of

Leon, Spain) and was used as described previously (34).

Southern Analysis

Leishmania total DNAs were isolated using DNAzol reagent as recommended by

the manufacturer (Invitrogen). For Southern blots, genomic DNAs were digested with Pvul

121

to monitor rearrangement events of the FBT family and with PstI for analysis of the

AdoMetTl-nu\l mutant. Southern blots, hybridizations, and washes were performed

following standard protocols (35), and all probes were obtained by PCR. The FBT gene

family was studied with a DNA probe spanning the conserved coding sequences ofthe FBT

genes (27), and AdoMetTl allele replacement was confirmed by using a probe targeting the

3 '-UTR of AdoMetTl.

Fluorescence Microscopy

Live parasites were mounted under poly-L-lysine-coated coverslips. Coverslips were

sealed with nail varnish and air-dried for 15 min. Bright field and fluorescence images were

taken using a Nikon Eclipse TE300 inverted microscope with a Photometries coolSNAPfx

camera. Visualization ofthe GFP fluorophore was achieved using a 460/500- nm excitation

filter and 510/560-nm emission filter with a lOOx objective. The images were processed

using the Image- Pro Plus software (version 5.0).

Results

Leishmania Methotrexate-resistant Mutant Is Cross-resistant to Sinefungin

Folic acid (FA) and AdoMet are the one carbon metabolic donors in cells, and

previous reports have demonstrated that AdoMet metabolism is potentially changed in

Leishmania cells resistant to the FA analogue MTX (29, 36). Indeed, the L. tarentolae

MTX1000.6 mutant is resistant to MTX (Fig. \A) due to decreased accumulation of MTX

or FA (see Fig. 2A and data not shown). This reduced accumulation is due to gene deletion

and rearrangements of the FBT transporter FT1 (37). Surprisingly, this mutant was also

found to be cross-resistant to the AdoMet analogue SNF (Fig. li?). This intriguing

observation led us to further investigate SNF susceptibility in Leishmania cells. L.

tarentolae and L. major wild-type cells were sensitive to MTX (Fig. \A). However,

although L. tarentolae and L. major LV39 were sensitive to SNF, L. major Friedlin was

intrinsically resistant to it (Fig. \B and Table 1). Similarly, whereas the L. infantum 263

strain was highly sensitive to SNF, the genome strain L. infantum JPCM5 was intrinsically

resistant (Table 1). L. tarentolae and L. major LV39 cells were selected in a step-by step

122

fashion for resistance to SNF, and these cells were indeed resistant to SNF (Fig. IB) but not

cross-resistant to MTX (Fig. \A).

Resistance to MTX in L. tarentolae MTX 1000.6 is due to a reduced uptake ofthe

drug (23), which is paralleled by a reduction in the uptake of the analogue FA (Fig. 2A).

Accordingly, we tested whether cross-resistance to SNF in L. tarentolae MTX 1000.6

correlated with a reduced accumulation of AdoMet and whether cells intrinsically resistant

(L. major Friedlin or L. infantum JCPM5) or made resistant to SNF also exhibited a

reduced accumulation of AdoMet. Wildtype L. tarentolae and L. major LV39 accumulated

AdoMet, but all strains not susceptible to SNF, regardless of whether resistance was

intrinsic or acquired, did not (Fig. 2B).

AdoMet Transporter Is a Member of the FBT Family

The L. tarentolae MTX 1000.6 mutant was resistant to both MTX and SNF (Fig. 1),

a phénotype accompanied by a reduced accumulation of FA and AdoMet (Fig. 2). Because

there are rearrangements ofthe FBT gene family in this mutant (30), we hypothesized that

the lack of AdoMet transport in this mutant could be correlated with FBT gene

rearrangements. This was also investigated in L. tarentolae and L. major cells made

resistant to SNF where the genomic DNAs of the mutants were digested with Pvul and

hybridized to a FBT probe. There were no clear rearrangements in the L. tarentolae-

resistant mutant SNF8 (results not shown). However, there was a clear rearrangement of

some of the FBT family members in the L. major-resistant LV39SNF4000.4 mutant

compared with its parental wildtype SNF-sensitive isolate (Fig. 3A). According to the

published genome sequence of L. major, the high molecular weight (>12 kb) rearranged

band most likely encodes three FBT genes (LmjFlO.0350, LmjFlO.0360, and

LmjF10.0370). The corresponding L. infantum orthologues LinJl0.0.0360, LinJl0.0.0370,

and LinJl 0.0.0380 were cloned into expression vectors and transfected in the SNF-resistant

cells L. tarentolae MTX1000.6 and LV39SNF4000.4. Cells transfected with LinJl0.0370

but not the other two constructs became highly sensitive to SNF (Fig. 3B and results not

shown). This transporter clearly did not correspond to FT1 (LinJl0.0400). Indeed, L.

tarentolae MTX1000.6 transfected with FT1 was still highly resistant to SNF (Fig.32?) but

became highly sensitive to MTX (Fig. 3Q. L. tarentolae MTX1000.6 transfected with

123

LinJlO.0370 remained resistant to MTX (Fig. 3C). Because LinJlO.0370 sensitized cells to

SNF, we tested whether it could correspond to a plasma membrane AdoMet transporter.

Plasma membrane localization was examined by fusing the FBT open reading frame

containing the gene of interest to GFP and analyzing the resultant transfectants by

fluorescence microscopy (Fig. 4A). The LV39SNF4000.4 mutant and L. major Friedlin did

not transport AdoMet (Figs. 2B and AB). However, when these cells were transfected with

LinJl0.0370, we observed an accumulation of AdoMet (Fig. AB). These results suggested

that LinJ 10.0370 may catalyze the transport of AdoMet, and it was thus renamed

AdoMetTl. L. tarentolae MTX1000.6 or SNF8 cells did not accumulate AdoMet, but the

same cells transfected with AdoMetTl were capable of transporting AdoMet (Fig. AC).

However, L. tarentolae MTX 1000.6 cells transfected with AdoMetTl did not transport FA,

whereas the same cells transfected with FT1 did (Fig. AD).

To further link AdoMetTl to AdoMet transport, we attempted to generate an L.

infantum AdoMetTl null mutant. Two replacement cassettes were made, which allowed

AdoMetTl to be replaced by either the NEO or ZEO genes (Fig. 5A). These constructs were

transfected independently in wild-type cells and selected for resistance to either G418 or

Zeocin. Leishmania is diploid, and when its DNA is digested with PstI and hybridized to a

3-UTR AdoMetTl probe, the resulting hybridized fragment should be 6.2 kb in length

(Fig. 5v4). Integration of either the NEO or ZEO cassette and digesting with PstI and

hybridizing to the same probe should lead to fragments of 5.5 and 5.7 kb, respectively (Fig.

5A). Analysis of wild-type cells and AdoMetTl/NEO or AdoMetTl/ZEO transfectants

digested with PstI and hybridized with the 3-UTR probe were completely consistent with

the above scenario (Fig. SB, lanes 1-3). The ZEO cassette was introduced in an

AdoMetTl/NEO clone, and molecular analysis of the resulting transfectant was consistent

with the generation of an AdoMetTl null mutant. Indeed, the 6.2-kb band corresponding to

the intact AdoMetTl gene disappeared, whereas bands corresponding to the integration of

NEO and ZEO inactivation cassettes were observed (Fig. 55, lane 4). The L. infantum-263

wild-type cells were sensitive to SNF (Fig. 5 Q and accumulated AdoMet (Fig. 5D).

However, the AdoMetTl/NEO cells exhibited intermediate sensitivity to SNF (Fig. SC) and

accumulated less AdoMet (Fig. 5, C and D). The NEO/ZEO AdoMetTl null mutant was

insensitive to SNF and did not accumulate any measurable AdoMet (Fig. 5, C and D). We

124

confirmed that these phénotypes were indeed due to the lack of AdoMetTl, because

transfection of an episomal add-back construct encoding AdoMetTl into the null mutant

rescued both the susceptibility to SNF and the transport of AdoMet (Fig. 5, C and D).

AdoMetTl Is a Specific High Affinity AdoMet Transporter Expressed Constitutively

The kinetic properties of AdoMetTl were studied, and the Km value was determined

to be in the 150-300 nM range for both L. major and L. infantum (Table 1). The Vm^

values was calculated to be at least 10 times higher in cells sensitive to SNF compared with

cells intrinsically less susceptible to SNF (Table 1). We tested whether AdoMetTl was

specific for AdoMet by challenging the accumulation of [3H]AdoMet with related

substrates. AdoMet itself and SNF were shown to inhibit the accumulation of the

radioactive substrate but neither adenosine nor adenine, cysteine, ornithine, methionine, or

homocysteine competed with AdoMet uptake (Fig. 6). Only 5-adenosylhomocysteine, at a

high concentration, was able to compete with the accumulation of AdoMet (Fig. 6).

The transport of FA mediated by the FBT member FT1 is stage-regulated in

Leishmania, with maximal activity in the logarithmic phase of growth (38). Indeed, during

the progression of the parasite toward its stationary phase, there is increased FT1 protein

degradation (37). We tested whether AdoMetTl and AdoMet transport were under similar

stage regulation. AdoMet transport increased during log phase, but in contrast to FA, it

remained constant during the stationary phase (Fig. 7). Consistent with these results,

AdoMetTl-GFP fusions were not degraded in the stationary phase of growth with the

fusion protein migrating at the expected 100-kDa size. Moreover, AdoMetTl-GFP was at

the level of the plasma membrane in stationary cells as deduced from fluorescence

microscopy (Fig. 7). The same lack of growth stage regulation was observed for both L.

major and L. infantum (Fig. 7 and results not shown).

Molecular Basis for Intrinsic and Acquired Resistance to Sinefungin

L. major Friedlin and L. infantum JPCM5 were intrinsically resistant to SNF,

whereas L. major LV39 and L. infantum-263 were sensitive to it. This correlates with a

decrease in the transport of AdoMet (Fig. 2 and Table 1) and most likely SNF (Fig. 6). We

sequenced the AdoMetTl gene in cells incapable of AdoMet transport, and we found that

125

the coding sequence ofthe gene was identical to the published sequence. We next measured

the expression of AdoMetTl by quantitative reverse transcription-PCR and found that its

expression was 20 times higher in L. major LV39 compared with L. major Friedlin (Fig.

8,4). The expression of the MAT and FT1 genes was similar in the two L. major strains (Fig.

8,4). The expression of AdoMetTl was also higher (3-fold) in the AdoMet-transporting

strain L. infantum-263 compared with L. infantum JPCM5 (Fig. 85). The expression of the

MAT gene was similar in the two L. infantum strains, but the FT1 gene was also expressed

at higher level in L. infantum-263 (Fig. 8B). Incidentally, we found that L. infantum-263

was more sensitive to MTX compared with strain JPCM5 (results not shown), an

observation that could be attributed to the difference in FT1 expression.

We also sequenced the AdoMetTl open reading frame in the SNF-resistant mutant

LV39SNF4000.4, and we compared that sequence with that of the L. major LV39 strain

and found that they were identical (results not shown). However, the expression of

AdoMetTl was down-regulated 11-fold in cells in which resistance was induced compared

with the wild-type cells as determined by quantitative reverse transcription-PCR (Fig. 8Q.

The reduction in AdoMetTl expression correlated with a decrease of the Fmax value in the

transport of AdoMet (Table 1). Unfortunately, this quantitative reverse transcription-PCR

assay could not be applied to SNF-sensitive and -resistant L. tarentolae, possibly because

the sequence of AdoMetTl in this species was too divergent.

Discussion

The first indirect evidence for an AdoMet transporter in Leishmania came from the

observation that SNF, an AdoMet analogue, had inhibitory effects against the parasite (39).

Biochemical evidence was later obtained that demonstrated both the capacity of

Leishmania to accumulate AdoMet (40) and that AdoMet and SNF shared the same uptake

system (21). Our study now identifies the high affinity AdoMet transporter in Leishmania

as AdoMetTl, a membrane protein in the FBT family. The FBT family is a novel class of

membrane proteins, which is part ofthe major facilitator superfamily (41, 42). They were

first characterized in Leishmania (30, 43) but are present also in other kinetoplastid

parasites (27) or in Apicomplexa parasites such as Plasmodium and Toxoplasma (AA, 45),

in plants, and in cyanobacteria (46). So far, the only function attributed to these proteins

126

was the transport of unconjugated (47, 48) or conjugated pterins such as FA (30, 37, 46,

49). With 14 members, Leishmania has the largest number of FBTs, but the function of

only three members, BTI, FT1, and FT5 is known. The remaining 11 Leishmania proteins

in the FBT family are unlikely to correspond to plasma membrane FA transporters (27).

The function of a fourth member of the FBT family, namely AdoMetTl, has now been

revealed. As such, it would be of interest to investigate the role of AdoMetTl homologues

in other organisms containing FBTs, to determine whether they too can transport AdoMet.

This would be particularly important in Trypanosoma brucei, the parasite responsible for

sleeping sickness. Indeed, based on the unique biochemical properties of AdoMet transport

in T brucei, it was suggested that the transporter could serve as a novel route for the

delivery of drugs (50). T. brucei has seven FBT homologues (27) and determining if any of

these functions in AdoMet transport would be an important endeavor. In particular, several

S-adenosylmethionine decarboxylase inhibitors are being developed against parasites (51-

53), and some of these may enter through an AdoMet transporter. Sinefungin, but none of

the individual AdoMet building blocks, can inhibit AdoMet uptake in T. brucei (22), and

this is consistent with our observations for Leishmania AdoMetTl (Fig. 6). The Km value of

the T. brucei AdoMet transport was reported to be in the millimolar range (54) indicating a

lower affinity than Leishmania AdoMetTl, which is in the nanomolar range (Table 1).

FBTs have also been described in plants with nine members in Arabidopsis, one of

which transports FA (46). The plastid AdoMet transporter, named SAMT1, is not a

member of the FBT family but is part of the MCF (15, 16). MCF proteins are also

responsible for AdoMet transport in yeast (13) and human mitochondria (14). Interestingly,

Leishmania also encodes MCF proteins, one of which appears to be an orthologue of the

mitochondrial AdoMet transporter (55). Disruption of the Arabidopsis SAMTl gene led to a

severe growth defect, but because the plants remained viable, it was suggested that other

proteins could be implicated in AdoMet transport (15). It is possible that one ofthe plant

FBTs could be involved as a secondary organellar AdoMet transporter.

The Leishmania AdoMetTl transports AdoMet specifically in the low nanomolar

range, whereas FT1, also a FBT member, exclusively transports FA in the nanomolar range

(37, 43). Other FBTs highly homologous to either AdoMetTl or FT1 transport neither

127

AdoMet nor FA. Because AdoMetTl and FT1 are 80% identical (27), it should be possible

to find key regions and eventually amino acids involved in substrate specificity.

Interestingly, AdoMetTl and FT1 are regulated very differently at the post-translational

level with FT1 being degraded in stationary phase (37), whereas AdoMetTl is expressed

constitutively (Fig. 7). Although the signals implicated in the degradation of FT1 are

unknown, the production of AdoMetTl/FT 1 fusion proteins could aid in identifying motifs

involved in protein degradation in Leishmania.

Sinefungin has been found to be active against several Leishmania species (39, 56)

but also against other parasites, including malaria (57), and the trypanosomes (58). It was

suggested to have the potential to serve as a lead compound for a novel antiparasitic drug

(59). However, some Leishmania strains were found to be intrinsically resistant to SNF

(60), a finding supported here with the intrinsic SNF resistance observed in L. major

Friedlin or L. infantum JPCM5 (Table 1). This phenomenon can now be plausibly

explained by the defect in AdoMet transport (Fig. 2B), which is also related to lower

AdoMetTl expression (Fig. 8) and to a reduced Pmax for AdoMet transport (Table 1). The

disruption of AdoMetTl also leads to SNF resistance (Fig. 5). Interestingly, the selection

for resistance to SNF in Leishmania was also correlated to a decrease in the expression of

AdoMetTl (Fig. 8). The mechanism by which this happens is not yet clear, but it could be

related to the gene rearrangement observed in our study (Fig. 3,4). Reduced RNA levels in

Leishmania are usually due to a decrease in gene copy number (61, 62), although other

mechanisms may also occur (63). Interestingly, in the yeast S. cerevisiae that also

transports AdoMet, resistance to SNF was shown to correlate with loss of function

mutations in the AdoMet transporter Sam3 (20). Although the overexpression of MAT was

shown to confer resistance to SNF in Leishmania (64), it is not involved in the decreased

susceptibility observed here because the expression of MAT was not changed in our

resistant cells at either the RNA (Fig. SC) or protein level (result not shown). The

expression of MA T was also not increased in cells with reduced expression of AdoMetTl

(Fig. 8) or in cells in which AdoMetTl was disrupted (results not shown). Leishmania

strains can be sensitive to SNF in the low nanomolar range (Fig. 1), but several strains

demonstrated no intrinsic susceptibility (Table 1) (60) possibly because of lower

AdoMetTl expression. We could nonetheless envisage using more lipophilic analogues of

128

SNF, which may not require a specific transporter, as novel chemotherapeutic agents

against Leishmania.

Pneumocystis appears to depend exclusively on AdoMet uptake to meet its AdoMet

needs (11), but Leishmania can either synthesize it or salvage it from its environment. We

have inactivated AdoMetTl in L. infantum (Fig. 5), and the resultant cells were viable,

showed no obvious growth defect, and retained the ability to infect macrophages (results

not shown). Several organisms use synthesis as their main source of AdoMet, so the

presence of proteins implicated in the uptake of exogenous AdoMet in major classes of

parasites (kinetoplastids and apicomplexa) is perplexing. Leishmania cycles in various

environments (insect vectors and mammalian hosts) with varying concentrations of

metabolites that could serve as building blocks for AdoMet synthesis. It may thus be

advantageous, under limiting concentrations of metabolic precursors, to import AdoMet

directly from the environment. Leishmania is a purine auxotroph with numerous salvage

pathways (65), and one could envision that under purine-poor conditions, the uptake of

AdoMet could serve as a purine source. Synthesis of AdoMet is energetically expensive

because for each molecule of AdoMet synthesized, the three high energy phosphodiester

bonds of ATP are hydrolyzed (9). When AdoMet is present in the environment, and under

energetic constraint, it may thus be advantageous for the parasite to import AdoMet instead

of synthesizing it. The Leishmania MAT activity is maximal during logarithmic phase of

growth and negligible in the stationary phase (7). If AdoMet is required during other

growth phases of the parasite, it could also be useful for the organism to import it to

compensate for a reduced rate of synthesis. Although cells without AdoMetTl (Fig. 5) or

cells with low AdoMetTl expression (Fig. 8) thrive well under laboratory conditions, it is

possible that under specific conditions they may be at a disadvantage or that the expression

of the gene is induced. The identification of the AdoMet transporter will now allow the

testing of some of these hypotheses in Leishmania and also in other organisms.

Acknowledgments

We thank Dr. Jeremy Mottram for the L. infantum JPCM5 strain and Dr. Balana-

Fouce for the anti-MAT antibody. We also thank Drs. Danielle Légaré, Angana Mukherjee,

Philippe Leprohon, and Jennifer Raven for critical reading ofthe manuscript.

129

References

(1) Herwaldt, B. L. (1999) Lancet 354, 1191-1199. (2) Murray, H. W., Berman, J. D., Davies, C. R., and Saravia, N. G. (2005) Lancet 366,

1561-1577. (3) Ouellette, M., Drummelsmith, J., and Papadopoulou, B. (2004) Drug Resist. Updat.

7, 257-266. (4) Croft, S. L., Sundar, S., and Fairlamb, A. H. (2006) Clin. Microbiol. Rev. 19, 111-

126. (5) Lu, S. C , and Mato, J. M. (2008) J. Gastroenterol. Hepatol. 23, S73-S77. (6) Fairlamb, A. H., and Cerami, A. (1992) Annu. Rev. Microbiol. 46, 695-729. (7) Reguera, R. M., Redondo, C. M., Pe'rez-Pertejo, Y., and Balan~a-Fouce, R. (2007)

Mol. Biochem. Parasitol. 152, 1-10. (8) Fontecave, M., Atta, M., and Mulliez, E. (2004) Trends Biochem. Sci. 29, 243-249. (9) Mato, J. M., Corrales, F. J., Lu, S. C , and Avila, M. A. (2002) FASEB J. 16,15-26. (10) Tucker, A. M., Winkler, H. H., Driskell, L. O., and Wood, D. O. (2003) J. Bacteriol.

185,3031-3035. (11) Merali, S., Vargas, D., Franklin, M., and Clarkson, A. B., Jr. (2000) J. Biol. Chem.

21S, 14958-14963. (12) Merali, S., and Clarkson, A. B., Jr. (2004) FEMS Microbiol. Lett. 237,179-186. (13) Marobbio, C. M., Agrimi, G., Lasorsa, F. M., and Palmieri, F. (2003) EMBO J. 22,

5975-5982. (14) Agrimi, G., Di Noia, M. A., Marobbio, C. M., Fiermonte, G., Lasorsa, F. M., and

Palmieri, F. (2004) Biochem. J. 379, 183-190. (15) Bouvier, F., Linka, N., Isner, J. C , Mutterer, J., Weber, A. P., and Camara, B. (2006)

Plant Cell 18, 3088-3105. (16) Palmieri, L., Arrigoni, R., Blanco, E., Carrari, F., Zanor, M. I., Studart- Guimaraes,

C , Fernie, A. R., and Palmieri, F. (2006) Plant Physiol. 142, 855-865. (17) Haferkamp, I. (2007) FEBSLett. 581, 2375-2379. (18) Rouillon, A., Surdin-Kerjan, Y., and Thomas, D. (1999) J. Biol. Chem. 21 A, 28096-

28105. (19) Uemura, T., Kashiwagi, K., and Igarashi, K. (2007) J. Biol. Chem. 282, 7733-7741. (20) Zheng, S., Shuman, S., and Schwer, B. (2007) Nucleic Acids Res. 35, 6895-6903. (21) Phelouzat, M. A., Basselin, M., Lawrence, F., and Robert-Gero, M. (1995) Biochem.

J. 305, 133-137. (22) Goldberg, B., Rattendi, D., Lloyd, D., Sufrin, J. R., and Bacchi, C. J. (1998) Biochem.

Pharmacol. 56, 95-103. (23) Papadopoulou, B., Roy, G., and Ouellette, M. (1993) Nucleic Acids Res. 21, 4305-

4312. (24) Ouellette, M., Fase-Fowler, F., and Borst, P. (1990) EMBOJ. 9, 1027-1033. (25) Papadopoulou, B., Roy, G, and Ouellette, M. (1992) EMBOJ. 11, 3601-3608. (26) El Fadili, A., Kundig, C, and Ouellette, M. (2002) Mol. Biochem. Parasitol. 124,

63-71. (27) Ouameur, A. A., Girard, I., Le'gare', D., and Ouellette, M. (2008) Mol. Biochem.

Parasitol. 162, 155-164.

130

(28) Moreira, W., Leblanc, E., and Ouellette, M. (2009) Free Radie. Biol. Med. 46, 367-375.

(29) Drummelsmith, J., Girard, L, Trudel, N., and Ouellette, M. (2004) J. Biol. Chem. 279, 33273-33280.

(30) Richard, D., Ku'ndig, C, and Ouellette, M. (2002) J. Biol. Chem. 277, 29460-29467. (31) Al-Salabi, M. I., Wallace, L. J., and De Koning, H. P. (2003) Mol. Pharmacol. 63,

814-820. (32) Gagnon, D., Foucher, A., Girard, L, and Ouellette, M. (2006) Mol. Biochem.

Parasitol. 150,63-71. (33) Foucher, A. L., Papadopoulou, B., and Ouellette, M. (2006) J. Proteome Res. S,

1741-1750. (34) Reguera, R. M., Balan~a-Fouce, R., Pe'rez-Pertejo, Y., Ferna'ndez, F. J., Garcia-

Estrada, C , Cubria, J. C , Ordo'nez, C , and Ordo'n~ez, D. (2002) J. Biol. Chem. 277,3158-3167.

(35) Sambrook, J., Fritsch, E. F., and Maniatis, T. (1989) Molecular Cloning: A Laboratory Manual, pp. 9.31-9.62, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY.

(36) Guimond, C , Trudel, N., Brochu, C , Marquis, N., El Fadili, A., Peytavi, R., Briand, G., Richard, D., Messier, N , Papadopoulou, B., Corbeil, J., Bergeron, M. G., Le'gare', D., and Ouellette, M. (2003) Nucleic Acids Res. 31, 5886-5896.

(37) Richard, D., Leprohon, P., Drummelsmith, J., and Ouellette, M. (2004) J. Biol. Chem. 279,54494-54501.

(38) Ellenberger, T. E., and Beverley, S. M. (1987) J. Biol. Chem. 262, 10053-10058. (39) Bachrach, U., Schnur, L. F., El-On, J., Greenblatt, C. L., Pearlman, E., Robert- Gero,

M., and Lederer, E. (1980) FEBS Lett. 121, 287-291. (40) Avila, J. L., and Polegre, M. A. (1993) Mol. Biochem. Parasitol. 58, 123-134. (41) Saier, M. H., Jr., Beatty, J. T., Goffeau, A., Harley, K. T., Heijne, W. H., Huang, S.

C, Jack, D. L., Ja'hn, P. S., Lew, K., Liu, J., Pao, S. S., Paulsen, I. T., Tseng, T. T., and Virk, P. S. (1999) J. Mol. Microbiol. Biotechnol. 1, 257-279.

(42) Chang, A. B., Lin, R., Keith Studley, W., Tran, C. V., and Saier, M. H., Jr. (2004) Mol. Membr. Biol. 21, 171-181.

(43) Dridi, L., Haimeur, A., and Ouellette, M. (2010) Biochem. Pharmacol. 79, 30-38. (44) Massimine, K. M., Doan, L. T., Atreya, C. A., Stedman, T. T., Anderson, K. S.,

Joiner, K. A., and Coppens, I. (2005) Mol. Biochem. Parasitol. 144, 44-54. (45) Wang, P., Wang, Q., Sims, P. F., and Hyde, J. E. (2007) Mol. Biochem.Parasitol.

154,40-51. (46) Klaus, S. M., Kunji, E. R., Bozzo, G. G., Noiriel, A., de la Garza, R. D., Basset, G. J.,

Ravanel, S., Re'beille', F., Gregory, J. F., 3rd, and Hanson, A. D. (2005) J. Biol. Chem. 280, 38457-38463.

(47) Kundig, C , Haimeur, A., Le'gare', D., Papadopoulou, B., and Ouellette, M. (1999) EMBOJ. 18,2342-2351.

(48) Lemley, C , Yan, S., Dole, V. S., Madhubala, R., Cunningham, M. L., Beverley, S. M., Myler, P. J., and Stuart, K. D. (1999) Mol. Biochem. Parasitol. 104, 93-105.

(49) Cunningham, M. L., and Beverley, S. M. (2001) Mol. Biochem. Parasitol. 113, 199-213.

(50) Goldberg, B., Yarlett, N., Sufrin, J., Lloyd, D., and Bacchi, C. J. (1997) FASEB J. 11, 256-260.

131

(51) Bacchi, C. J., Barker, R. H., Jr., Rodriguez, A., Hirth, B., Rattendi, D., Yarlett, N., Hendrick, C. L., and Sybertz, E. (2009) Antimicrob. Agents Chemother. 53, 3269-3272.

(52) Hirth, B., Barker, R. H., Jr., Celatka, C. A., Klinger, J. D., Liu, H., Nare, B., Nijjar, A., Phillips, M. A., Sybertz, E., Willert, E. K, and Xiang, Y. (2009) Bioorg. Med. Chem. Lett. 19,2916-2919.

(53) Barker, R. H., Jr., Liu, H., Hirth, B., Celatka, C. A., Fitzpatrick, R., Xiang, Y., Willert, E. K., Phillips, M. A., Kaiser, M., Bacchi, C. J., Rodriguez, A., Yarlett, N., Klinger, J. D., and Sybertz, E. (2009) Antimicrob. Agents Chemother. 53, 2052-2058.

(54) Goldberg, B., Rattendi, D., Lloyd, D., Yarlett, N., and Bacchi, C. J. (1999) Arch. Biochem. Biophys. 364, 13-18.

(55) Colasante, C, Pena Diaz, P., Clayton, C, and Voncken, F. (2009) Mol. Biochem. Parasitol. 167,104-117.

(56) Paolantonacci, P., Lawrence, F., and Robert-Géro, M. (1985) Antimicrob. Agents Chemother. 28, 528-531.

(57) Trager, W., Tershakovec, M., Chiang, P. K., and Cantoni, G. L. (1980) Exp. Parasitol. 50, 83-89.

(58) Dube, D. K., Mpimbaza, G., Allison, A. C, Lederer, E., and Rovis, L. (1983) Am. J. Trop. Med. Hyg. 32, 31-33.

(59) Nolan, L. L. (1987) Antimicrob. Agents Chemother. 31, 1542-1548. (60) Avila, J. L., and Avila, A. (1987) Mol. Biochem. Parasitol. 26, 69-75. (61) Ubeda, J. M., Légaré, D., Raymond, F., Ouameur, A. A., Boisvert, S., Rigault, P.,

Corbeil, J., Tremblay, M. J., Olivier, M., Papadopoulou, B., and Ouellette, M. (2008) Genome Biol. 9, R115.

(62) Leprohon, P., Légaré, D., Raymond, F., Madore, E., Hardiman, G., Corbeil, J., and Ouellette, M. (2009) Nucleic Acids Res. 37, 1387-1399.

(63) Marquis, N , Gourbal, B., Rosen, B. P., Mukhopadhyay, R., and Ouellette, M. (2005) Mol. Microbiol. SI, 1690-1699.

(64) Pérez-Pertejo, Y., Reguera, R. M., Ordonez, D., and Balafia-Fouce, R. (2006) Biochim. Biophys. Acta 1760, 10-19.

(65) Landfear, S. M., Ullman, B., Carter, N. S., and Sanchez, M. A. (2004) Eukaryot. Cell 3, 245-254.

132

Table 1

Susceptibility to sinefungin and kinetic properties ofS-adenosy I methionine transport in Leishmania spp. The IC50 values are 50% inhibitory concentrations of sinefungin. The means ±S.D. of at least three independent experiments are given.

Strains IC50 value of sinefungin

Km ' m a x

nM nM pmol/10 cells/min

L. infantum MHOM/MA/ 80 ±18 167 ±27 0.56 ±0.17 67/ITMAP-263 L. infantum JPCM5 2000 ± 300 180 ±82 0.05 ± 0.01 L. major LV39 50 ± 4 252 ±10 0.57 ±0.13 L. major Friedlin >6000 320 ± 7 0.03 ± 0.01 LV39SNF4000.4 + AdoMetTl-GFP 10 ± 2 284 ± 72 0.58 ± 0.24

Legend to figures

Fig. 1. Sensitivity of Leishmania cells to methotrexate and sinefungin. Leishmania cells

were incubated in SDM medium with varying concentrations of methotrexate (A) and

sinefungin (B), and their growth was monitored at 72 h by measuring the absorbance at 600

nm. # , L. tarentolae wild type; O, L. tarentolae MTX1000.6; A, TarSNF.8; A, L. major

Friedlin; ■, L. major LV39; □, LV39SNF4000.4. The average of triplicate measurements

is shown.

Fig. 2. Folic acid and S-adenosj Imcthioninc accumulation in Leishmania cells. The

accumulation of 115 nM [3H]folic acid (A) and 60 nM 5-[3H]adenosylmethionine (B) was

measured in Leishmania cells. • , L. tarentolae wild type;0, L. tarentolae MTX1000.6; A.

TarSNF.8; A, L. major Friedlin; ■, L. major LV39; □, LV39SNF4000.4. The average of

triplicate measurements is shown.

133

Fig. 3. Identification of the 5-adenosyImethionine transporter (AdoMetTl) of

Leishmania. (A), Southernblot analysis of L. major LV39 and LV39SNF40004. Total

DNAs of Leishmania cells were digested with Pvul, transferred to a nylon membrane, and

hybridized to a 700-bp probe derived from the conserved regions of the FBTs. (B),

susceptibility of Leishmania cells to sinefungin. (C), susceptibility of Leishmania cells to

methotrexate. ♦ , TarMTX1000.6 transfected with AdoMetTl; O, TarMTX1000.6

transfected with FTP, V, LV39SNF4000.4 transfected with AdoMetTl. The average of

triplicate measurements is shown (for B and C).

Fig. 4. Functional characterization of AdoMetTl. (A), fluorescence microscopy analysis

of LV39SNF4000.4 cells expressing AdoMetTl-GFP. LV39SNF4000.4 cells were

transfected with a plasmid where the AdoMetTl gene and the GFP gene were fused in-

frame. Analysis of transfectants by fluorescence microscopy indicated that the fusion

protein was localized mainly in the plasma membrane of the parasite. (B), transport of 60

nM S-[3H]adenosylmethionine inL. major cells. A, L. major Friedlin; ■, L. major Friedlin

transfected with AdoMetTl; □, LV39SNF4000.4; V, LV39SNF40004 transfected with

AdoMetTl-GFP; T , LV39SNF4000.4 transfected with AdoMetTl. (C), transport of 60 nM

S-[3H]adenosylmethionine in L. tarentolae cells. O, TarMTXl000.6 transfected with GFP;

♦ , TarMTXlOOO.6 transfected with AdoMetTl-GFP; O, TarMTX1000.6 transfected with

FTP, A, TarSNF.8; T , TarSNF.8 transfected with AdoMetTl-GFP. (D), transport of 115

nM [3H]folic acid in L. tarentolae cells. ♦ , TarMTXl 000.6 transfected with AdoMetTl-

GFP; O, TarMTX1000.6 transfected with FT1-GFP. The average of triplicate experiments

are shown (B-D).

Fig. 5. Generation and characterization of L. infantum AdoMetTl null mutant. (A),

genomic organization of the AdoMetTl locus. The AdoMetTl upstream and downstream

fragments used for the integration of the NEO and ZEO cassettes are shown. P, PstI. UTR,

untranslated region. (B), Southern blots of L. infantum genomic DNA digested with PstI

and hybridized to a AdoMetTl-3 'UTR probe. Lane 1, L. infantum wild type; lane 2, L.

infantum with one AdoMetTl allele disrupted with the NEO cassette; lane 3, L. infantum

with one AdoMetTl allele disrupted with a ZEO cassette; lane 4, L. infantum AdoMetTl

null mutant with integrated NEO and ZEO cassettes. (C), sinefungin susceptibility of

134

Leishmania cells. (D), transport of 60 nM 5-[3H]adenosylmethionine by Leishmania cells.

# , L. infantum wild type; O, L. infantum AdoMetTl with one inactivated allele; A, L.

infantum AdoMetTl null mutant; A, L. infantum AdoMetTl null mutant transfected with a

add-back AdoMetTl plasmid. The average of triplicate measurements is shown for C and

D.

Fig. 6. Substrate specificity profile of AdoMetTl in L. major. LV39SNF4000.4 cells

expressing AdoMetTl-GFP were co-incubated for 10 min with 50 nM S-

[ H]adenosylmethionine and cold substrate competitors at various concentrations (100 nM

and 1 and 10 pM). Results represent the percent of 5'-[3H]adenosylmethionine accumulation

in competed samples versus the accumulation of a non competed control. The average of

triplicate measurements is shown.

Fig. 7. Growth stage regulation of 5-adenosylmethionine transport activity.

Accumulation of 60 nM S-[3H]adenosylmethionine was measured along the growth phases

(48, 72, 96, and 120 h) for 10 min in L. infantum wild type (white bars), LV39SNF4000.4

transfected with AdoMetTl-GFP (gray bars), and L. major LV39 wild type (black bars).

Average of triplicate measures is shown. Western blot with an anti-GFP antibody or with a

control ct-tubulin antibody to monitor the amounts of proteins layered was carried out with

LV39SNF4000.4 transfected with AdoMetTl-GFP as described under "Materials and

Methods." Cellular localization of AdoMetTl was deduced from fluorescence microscopy

analysis of LV39SNF40004 transfected with the AdoMetTl gene fused in-frame with the

GFP gene. The majority of the fluorescence derived from the AdoMetTl-GFP hybrid

protein was at the level ofthe plasma membrane throughout the various growth stages.

Fig. 8. RNA expression of targeted one-carbon metabolism genes in Leishmania cells.

The expression ofthe genes coding for the AdoMet transporter AdoMetTl, ofthe folate

transporter FT1, and of the methionine adénosyltransférase MAT were measured by

quantitative real time reverse transcription-PCR as described under "Materials and

Methods." The expression was compared in the following: (A), L. major LV39 versus L.

major Friedlin, respectively, sensitive and insensitive to SNF; (B), L. infantum-263 versus

L. infantum JPCM5 (respectively, sensitive and less sensitive to both SNF and MTX); (C),

135

L. major LV39 versus the sinefungin-resistant mutant LV39SNF4000.4. For all bars, mean

of biological triplicates is presented.

B

200 400 600 800 1000 Methotrexate (uM)

0.2 0.4 0.6 0.8 Sinefungin (uM)

Figure 1

136

B 1.4-,

2 4 6 Time (min)

10

2 4 6 Time (min)

10

Figure 2

137

kb

12-

5-4-

1 2

- m*

• §

B 120

10' ! & * > -

£ 804 S o ai 60-

2 -

40

20

0 E

- 0 — -o 120-.

KXKW + ♦-

0.2 0.4 0.6 0.8 1 Sinefungin (uM)

•c 80 î o a> 60 o S2 40

20

0

-V- -$

200 400 600 800 1000 Methotrexate (pM)

Figure 3

138

4 6 Time (min)

Figure 4

139

P 1

6.2 kb P 1 ■ ■

M r i 5 UTR AdoMetT l 3 'UTR "> '

P#

r P j

5.5 k b W

r P j 1

f t r 5 'UTR 1 NEO | 3 'UTR

p P*

5.7 k b

p P*

p

— ' — / //-p

1 5 'UTR I Z E O l 3 'UTR p

— ' — /

B „K 1 2 3 4 kb i—:

6 - h * ♦■ AdoMetTl

>-ZEO ♦-NEO

200 400 600 800 1000 1200 Sinefungin (nM)

2 4 6 Time (min)

Figure 5

140

Adenosine

Adenine

Cysteine

Ornithine

Methionine

Homocysteine

S-Adenosylhomocysteine

Sinefungin

S-Adenosylmethionine

10 pM 1 pM

100 nM

10 MM 1 uM

100 nM

10 pM 1 gM

100 nM

10 pM 1pM

100 nM

10 MM 1pM

100 nM

10pM 1 pM

100 nM

10 pM 1 pM

100 nM

10 pM 1pM

100 nM

10 MM 1 MM

100 nM

No inhibitor

Fr

10 20 30 40 50 60 70 80 90

S-Adenosylmethionine uptake (%)

100 110 120

Figure 6

141

48 h 72 h 96 h 120 h

AdoMetTl-GFP

cc-tubulin i ^ ^

100 kDa

55 kDa

Figure 7

142

AdoMetTl AdoMetTl MAT AdoMetTl MAT

Figure 8

143

Chapitre IV. Localisation intracellulaire des protéines de la famille des transporteurs de folate et de la bioptérine (FBT) et de la famille des transporteurs mitochondriaux (MCF) chez Leishmania.

Une version complète de l'article sera bientôt soumise pour publication

4.1 Résumé

Les folates réduits et la S-adénosylméthionine (AdoMet) sont des donneurs d'unités

à un carbone (Cl) nécessaires pour la synthèse de l'ADN, le métabolisme des acides

aminés et pour les réactions de methylation cellulaire. Chez les parasites trypanosomatides,

le transport cellulaire des folates et d'AdoMet est assuré par certains membres de la famille

des transporteurs de folate et de la bioptérine (FBT), mais le transport de ces metabolites

dans la mitochondrie n'a pas été étudié. Dans cette étude, nous rapportons la localisation

intracellulaire des protéines de la famille FBT de Leishmania en générant des fusions FBT-

GFP. Nous avons déterminé que la plupart des protéines FBT sont localisées au niveau de

la membrane plasmique du parasite, tandis que trois protéines sont localisées au niveau des

compartiments intracellulaires. Chez les eucaryotes supérieurs, les protéines appartenant à

la famille des transporteurs mitochondriaux (MCF) sont responsables de l'import des

folates et d'AdoMet dans certains organites. Nous avons détecté des orthologues de ces

protéines dans le génome de Leishmania et confirmé leur localisation mitochondrial. Ces

expériences de localisation protéique sont un pré-requis pour déterminer la fonction des

protéines de la famille FBT et celles de la MCF.

144

4.2 Article

Intracellular localization of folate/bioptcrin transporter (FBT) and mitochondrial

carriers family (MCF) proteins in Leishmania.

Amin Ahmed Ouameur, Jean-François Ritt, Danielle Légaré and Marc Ouellette*

Centre de Recherche en Infectiologie du CHUL, Université Laval, Québec, Qc, Canada.

Corresponding author : Marc Ouellette Ph.D. Centre de Recherche en Infectiologie 2705 Boul. Laurier Québec, Qc. Canada GI V 4G2 Tel : 1-418-654-2705 Fax: 1-418-654-2715 E-mail : Marc.Ouellette@crchul.ulaval.ca

Running title: The FBT family and the MC family of Leishmania.

Keywords: Leishmania, FBT family, mitochondrial carrier family (MCF), folates, S-

adenosylmethionine, methotrexate, sinefungin.

145

Abstract

Reduced folates and S-adenosylmethionine (AdoMet) are essential one-carbon

donors required for DNA synthesis, amino acids metabolism and methylation reactions. In

trypanosomatid parasites, the cellular uptake of folates and AdoMet is ensured by members

of the folate/biopterin transporters (FBT) family, but transport of these solutes into the

mitochondrion has not yet been studied. In this work, the cellular localization of the FBT

family proteins of Leishmania was investigated experimentally by generating FBT-GFP

fusions. Results revealed that the majority of the FBT proteins are localised at the plasma

membrane while only three were located to the membranes of intracellular compartments.

In higher eukaryotes, members of the mitochondrial carrier family (MCF) are responsible

for uptake of folates and AdoMet into organelles. Orthologous mitochondrial carrier

proteins (MCPs) were detected in the Leishmania sequence databases. Fluorescence

microscopy analyses of cells overexpressing MCP-GFP fusions demonstrated that they

localised to the mitochondrial membranes. These localisation efforts are a prerequisite for

further functional studies of FBT and MCF intracellular membrane proteins.

146

Introduction

Leishmania parasites are responsible for leishmaniasis, a disease with clinical

symptoms that ranges in severity from self-healing skin lesions to visceral infections, the

latter being usually fatal if left untreated (1). Leishmaniasis is endemic in 88 countries and

affects several millions of people each year (http://www.who.int/leishmaniasis). Despite

substantial efforts, no protective vaccine is available for leishmaniasis, and treatment is

based on chemotherapy which relies on a rather limited arsenal of drugs including

pentavalent antimonials, liposomal amphotericin B, pentamidine and miltefosine (1, 2).

Although effective in most cases, many problems have however been associated with anti-

leishmanial chemotherapy, notably side effects, high costs and drug resistance (3, 4). New

drugs and new therapeutic targets for drug and vaccine development are therefore urgently

required.

Historically, the folate metabolic pathway has been successfully exploited for the

treatment of a variety of infectious diseases, with the folic acid-reducing enzyme

dihydrofolate reductase (DHFR) as a common therapeutic target (5-7). Reduced folates

(e.g. tétrahydrofolate (THF) and its derivatives) are essential coenzymes in diverse

metabolic reactions, collectively known as one-carbon metabolism, that involve the transfer

of one-carbon units (Fig. 1) for the synthesis of various important metabolites. In

eukaryotic cells, one-carbon metabolism is compartmentalized between the cytoplasm and

organelles. In the cytoplasm, it is involved in the synthesis of thymidylate and purines, the

serine-glycine interconversion, the reméthylation of homocysteine to methionine and the

biosynthesis of S-adenosylmethionine (AdoMet). In the mitochondria, one-carbon

metabolism is required for the serine-glycine interconversion and the synthesis of

formylated methionyl-tRNA (fMet-tRNA) for mitochondrial protein synthesis (8-10).

Folates are composed of a pterin ring, a p-aminobenzoic acid (pABA) moiety, and a

glutamic acid chain of variable length (Fig. 1). Leishmania parasites are auxotroph for

ptéridines (folates and biopterin) and must acquire them from the environment (11).

The cellular transport of both folic acid and biopterin has been extensively studied

in Leishmania spp. (11) and the plasma membrane transporters (named FT1, FT5 and BTI)

mediating the selective uptake of those molecules were cloned and functionally

147

characterized (12-16) (Fig. 1). These transporters belong to the folate/biopterin transporters

(FBT) family (17) within the major facilitator superfamily (MFS) (18, 19). Members ofthe

FBT family were found in protozoan parasites, cyanobacteria and higher plants, with

Leishmania representing the organism with the largest FBT dataset (14 members) (17). The

two other members of the FBT family shown to transport folate are Slr0642 protein from

the cyanobacterium Synechocystis and its Arabidopsis ortholog At2g32040 which is located

to the chloroplast envelope (20). Recently, a new Leishmania FBT member was

characterised and found to be the main 5-adenosylmethionine transporter (AdoMetTl) (21).

While the plasma membrane transporters involved in the uptake of folates and S-

adenosylmethionine into the cytosol are known, the traffic of those molecules between the

cytosol and the unique mitochondrion has not been studied yet in Leishmania.

The existence of carrier-mediated systems responsible for folates and AdoMet

transport from the cytosol into intact organelles (mitochondria, chloroplast, Golgi vesicles

and vacuoles) has been demonstrated in higher eukaryotic cells (22-26). The genes

encoding the folates and AdoMet organellar transporters have now been cloned and

functionally characterised in humans (folates and AdoMet) (27-30), yeast (AdoMet) (31)

and Arabidopsis (folates and AdoMet) (32-34). All those carrier proteins possess the

characteristic sequence features of the mitochondrial carrier family (MCF), which is

defined as a large and diverse group of structurally related proteins that transport a variety

of substrates across the inner mitochondrial membrane, and other organellar membranes

(35-38). All MCF members exhibit a tripartite structure consisting of three tandemly

repeated homologous domains of about 100 amino acids in length, containing each two

transmembrane alpha-helice domains connected by a hydrophilic loop and a conserved

signature sequence motif. Both the N- and C-termini are located on the cytosolic side (38,

39). Searching genome databases using the sequence features of the MCF proteins has

revealed that the Saccharomyces cerevisiae genome encodes 34 mitochondrial carriers

(MCs) (37), that of Arabidopsis thaliana revealed 58 MCs (38) and the human genome is

encoding at least 49 MCs (35, 36). MCF proteins were also identified in trypanosomatid

parasites (40). In this work, we describe the localization of the remaining uncharacterized

putative members of the FBT family, and the identification and molecular characterization

of several mitochondrial carriers in the protozoan parasite Leishmania.

148

Materials and Methods

Leishmania growth conditions

The Leishmania infantum (strain MHOM/MA/67/ITMAP-263) and Leishmania

tarentolae methotrexate (MTX)-resistant mutant TarMTXl000.6 were cultured as

promastigotes in SDM-79 medium supplemented with 10% heat-inactivated fetal bovine

serum, and 5 pg/ml hemin. The TarMTXl 000.6 mutant was obtained by stepwise selection

as described previously (41). Cell growth was monitored by measuring the absorbance of

culture aliquots at 600 nm in a multiwell scanning spectrophotometer.

Sequence searches and analyses

Leishmania infantum genome databases (www.genedb.org and

www.ncbi.nlm.nih.gov) were screened with the sequences ofthe functionally characterised

organellar folate transporters (hMFT, AtFOLTl) (28-30, 32), AdoMet transporters (Sam5p,

SAMC, SAMT1/SAMC1) (27, 31, 33, 34) and thiamine pyrophosphate transporters TPC

and TPC1 (42, 43) using the web tool BLASTP. The amino acid sequences obtained were

used for reciprocal BLASTP search to eliminate false positives.

DNA manipulations

The complete coding regions of the FBT family proteins and the identified putative

folate, AdoMet, and thiamine mitochondrial carrier proteins (MCP) were amplified from

genomic DNA of Leishmania infantum strain MHOM/MA/67/ITMAP-263 by PCR using

two pairs of forward (FW) and reverse (RV) primers (see Table SI, supplementary

material). Each FW and RV primers contain unique restriction enzyme site (e.g. Xbal,

Hindlll, BamHI, Bglll, Sail, EcoRI) for the cloning of the wild-type gene into

pSP72 ccHYGa vector (44) or for in-frame cloning with a C-terminal green fluorescent

protein GFP tag using the plasmid pSP12aNEOa-GFP (17). DNA transfection into

Leishmania cells and selection ofthe recombinant cells were performed as described (45).

149

Fluorescence Microscopy

Promastigote cells expressing the green fluorescence protein (GFP)-fusion proteins

were washed with Hepes/NaCl buffer (21 mM Hepes, pH 7.2, 137 mM NaCl, 5 mM KC1,

0.7 mM Na2HPÛ4, 6 mM glucose), immobilized in Hepes/NaCl buffer containing 5%

glycerol, mounted on microscope slides with coverslips and visualised by epifluorescence

microscopy as described (21). Staining with 20 nM MitoTracker Red CMXRos

(Invitrogen-Molecular Probes) was performed in Hepes-NaCl buffer at 24 °C for 30 min

followed by 2 washes in Hepes/NaCl. Visualization of the MitoTracker fluorescence was

achieved using a 532-588 nm excitation filter with a 607-683 nm emission filter. The

images were processed using ImageJ version 1.42 (National Institutes of Health, USA;

http://rsb.info.nih.gov/ij).

Results

Subcellular localization of the putative members of the FBT family in Leishmania

The genome of Leishmania encodes for 13 proteins of the FBT family and to date

only four proteins were functionally characterized namely the biopterin transporter BTI

(13, 14), the two folic acid transporters FT1 and FT5 (12, 15, 16) and the S-

adenosylmethionine transporter AdoMetTl (21). Those proteins along with the two other

functionally uncharacterized proteins LinJlO.0410 and LinJ19.0870 (17) have been

reported to be located at the plasma membrane ofthe parasite. However, the localization of

the remaining Leishmania FBT members is unknown and the identity ofthe mitochondrial

folates and AdoMet carriers remain to be defined. The human reduced folate carrier (RFC)

has been localized at the cell surface membrane as well as in the mitochondrial membrane

(46), suggesting a role for the mitochondrial isoform in the transport of folates. In silico

analysis ofthe L. infantum FBT family proteins using different programs for signal peptide

detection and protein localization failed to predict a mitochondrial localization for these

proteins. However, the prediction results from the PSORT II program

(http://psort.hgc.jp/form2.html) suggested that all Leishmania members of the FBT family

were plasma membrane proteins, with the exception of LinJ04.0020 which was predicted as

an endoplasmic reticulum protein (data not shown). In order to identify putative

150

mitochondrial proteins among the FBT family members, the subcellular localization of the

remaining uncharacterized FBT proteins was verified experimentally. This was done by

fusing to the C-terminal of the coding sequence of each FBT proteins the coding sequence

of the green fluorescence protein (GFP) using the Leishmania expressing vector

pSPaNEOa-GFP (17). A first series of six FBT-GFP fusion constructs (LinJ04.0020,

LinJ06.0310, LinJ10.0360, LinJlO.0370, LinJlO.0390, LinJlO.1450) were transfected in

both L. infantum and L. tarentolae. Since the expression patterns were strictly identical in

both species, the remaining FBT-GFP fusion constructs were transfected in either L.

infantum (LinJ35.5120) or L. tarentolae (LinJ06.1320, LinJ10.0380, LinJlO.0400,

LinJ 10.0410, LinJl0.0420, LinJ 19.0870). The expression patterns presented in figure 2

showed that only three FBT proteins (LinJ04.0020, LinJ06.0310 and LinJl0.0360) were

located in intracellular compartments, while the remaining 10 members were at the plasma

membrane. Indeed, cells overexpressing the LinJ04.0020-GFP protein fusion showed a

GFP fluorescence signal located to the membrane of small intracellular vesicles, cells

overexpressing the LinJ06.0310-GFP protein showed a fluorescence signal located near the

flagellar pocket and cells overexpressing the LinJ10.0360-GFP fusion revealed a

fluorescence signal detected near the flagellar pocket and also to the membrane of small

intracellular vesicles (Fig. 2). The N-terminal GFP fusions were also produced for the three

putative intracellular FBT proteins and these were found to localize into similar

compartments as the C-terminal fusions (result not shown).

Identification of the mitochondrial carriers for folates, AdoMet and thiamine

Proteins belonging to the mitochondrial carrier family (MCF) have been described

to be responsible for the uptake of a variety of molecules across the membrane of different

organelles (e.g. mitochondria, plastid, peroxisomes, endoplasmic reticulum) (39, 47). We

started searching in the Leishmania infantum genome databases for genes encoding putative

orthologs of the previously functionally characterized folate, AdoMet and thiamine MCF

transporters from other eukaryotes (27, 30-34) using BLASTP search and found that

several candidates were putative members of the mitochondrial carrier family. One specific

ortholog was identified for AdoMet or thiamine substrates, namely LinJ32.0110 (37/46 %

identical/similar amino acid with SAMC) and LinJ 19.1090 (27/46 % identical/similar

amino acid with TPC), respectively, while three orthologs were identified as the potential

151

ortholog for the folate transporter, namely LinJ32.1170, LinJ32.1180 and LinJ35.3380

(respectively; 27/49 %, 28/44 % and 31/46 % identical/similar amino acid with AtFOLTl).

However, we cannot exclude that the later transporters could mediate the transport of other

substrates, as they also group with pyrimidine nucleotide and NAD mitochondrial

transporters (Table 1, Fig. SI-supplementary data). During the cloning of the in silico

identified L. infantum MCPs, the trypanosomatid mitochondrial carrier family proteins

were inventoried and classified into functional groups using sequence analysis and

phylogenetic reconstruction (40). In this work, the Arabidopsis database was not taken into

account for BLASTP analysis, although our results are in close agreement with their

conclusions. At the time of writing, the function of all members of trypanosomatid MCF

proteins is unknown. However, it should be noted that the MCF member MCP6 of T.

brucei, a putative ADP/ATP carrier, was cloned but the transport assay suggested that

MCP6 does not function as either an ADP/ATP or ATP-Mg/Pi carrier (48).

Mitochondrial localization of the identified mitochondrial carrier proteins (MCP)

The subcellular localization of the putative mitochondrial transporters for folate,

AdoMet and thiamine pyrophosphate was assessed by producing MCP-GFP constructs

using the same strategy as for the FBT proteins (17). The MCP-GFP constructs were

transfected in Leishmania infantum promastigote cells and the localization of the MCP-

GFP fusions was revealed by epifluorescence microscopy analyses of the recombinant

cells. The expression patterns (Fig. 3) clearly demonstrated that the five tested MCPs

(LinJ32.1170, LinJ32.1180, LinJ35.3380, LinJ32.0110 and LinJ19.1090) localize to the

parasite mitochondrion, as confirmed by the perfect co-localization (Fig. 3, merge panels A

and B) ofthe green fluorescence (Fig. 3, GFP panels) associated to the MCP-GFP fusions

with the red fluorescence (Fig. 3, MitoTraker panels) associated to the MitoTracker Red

probe. As a control, cells overexpressing the GFP protein revealed a fluorescence signal

located throughout the cytoplasm and the flagella (Fig. 3, pSP aNEOa-GFP).

Discussion

Leishmania is a folate-auxotroph organism and relies exclusively on exogenous

folate uptake for cellular and organellar one-carbon metabolism. In contrast, Leishmania is

prototroph for AdoMet and has also the ability to import it (Fig. 1). Only one type of

152

transport system has been characterized for folate and AdoMet in Leishmania; the cellular

uptake ensured by high affinity transporter proteins belonging to the folate/biopterin

transporters (FBT) family (Fig. 1) ((21) and reference therein). In total, 14 different FBT

genes encoding 13 different proteins are predicted in Leishmanial genome (17). The

majority of those proteins are functionally uncharacterized but most of them are found to be

located at the parasite plasma membrane (Fig. 2). Some plasma membrane proteins, like

LinJlO.0410 (97 % similar amino acids with the folate transporter FT1) and LinJ19.0870

(61 % similar amino acids with FT1) do not function as folic acid transporters (17) nor as

biopterin or AdoMet transporters (data not shown), suggesting a putative role of those

proteins in transport of different substrates. Current literature suggests that reduced folate

derivatives (in particular folmyl-THF) and AdoMet are also required for mitochondrion

metabolism in Leishmania (49-52). Hence the hypothesis about the possible localization of

particular FBT members of Leishmania in the mitochondrial membrane. It should be noted

that the Arabidopsis folate transporter At2g32040, within the FBT family, is located into

the chloroplast envelop (20).

The analysis of the Leishmania cells overexpressing the FBT-GFP fusions revealed

that only three proteins (LinJ04.0020, LinJ06.0310 and LinJ 10.0360) among the 13 tested

FBT proteins were localized into intracellular compartments (Fig. 2). While the expression

patterns of those proteins remains to be confirmed by subcellular fractionation and Western

blotting analyses, it seems that their localization pattern is unlikely to be in the

mitochondrion as shown for the MCF proteins (Fig. 3). However, the GFP fluorescence

signals of the three FBT-GFP fusion proteins might correspond to the endoplasmic

reticulum (ER)-Golgi network of the parasite. Indeed, the fusion proteins LinJ04.0020-

GFP, LinJ06.0310-GFP and LinJl0.0360-GFP might define the endoplasmic reticulum

(ER) (at the periphery of the nucleus envelop), the Golgi apparatus (G)/endosomes

(proximal to the flagellar pocket) and the Golgi apparatus/ER, respectively ((53) and

references therein). Interestingly, early biochemical studies demonstrated that in plants,

AdoMet is transported into the Golgi apparatus and endoplasmic reticulum for protein

methylation, but the transporter is yet unknown (24). Inhibition of the nucleotide sugar

transporters of the Golgi apparatus (54) showed little effects on AdoMet transport,

excluding the involvement of these transporters in AdoMet uptake (24). Another

153

transporters family associated with the transport of AdoMet is the mitochondrial carrier

family (MCF) and members of this family are found in different organelles like

mitochondria, plastid, peroxisomes and endoplasmic reticulum (39, 47). However, since

MCF proteins that could be involved in the AdoMet transport into the ER-Golgi apparatus

are not yet identified, we postulate that the three intracellular located FBT proteins revealed

in the present study might be interesting candidates for AdoMet transport studies.

Folate and AdoMet transport activities have been detected previously in purified

mitochondria (22, 23). The genes encoding folate transporters have now been cloned in

human and Arabidopsis (30, 32) while genes encoding AdoMet transporters have been

cloned in yeast, human and Arabidopsis (27, 31, 33, 34). Those proteins belong to the

mitochondrial carrier family (MCF) and members of this family are also found in

trypanosomatids (40). Leishmania genome encodes for at least 32 MCPs which could be

classified into different functional groups (Fig. IS). A genome-based prediction strategy

combining sequence similarity search (Table 1) and phylogenetic analysis (Fig. SI)

revealed that one specific putative MCP could potentially transport AdoMet, another one

thiamine, while three MCPs could potentially transport folates. Molecular analyses of these

MCPs provide evidence that they are putative mitochondrial transporters (Fig. 3). The

functional role of those proteins could be investigated by transport studies using different

approaches: (i) by comparing the transport activity of the purified mitochondria between

cells overexpressing the MCP-GFP fusion proteins, MCP-mutant cells (knock-out cells)

and control cells (expressing only the GFP protein); (ii) by expression of MCP-GFP fusion

proteins into IPTG-inducible E. coli strain; (iii) or by protein purification and reconstitution

into liposomes. Several substrates might be tested for the transport studies, like folic acid

and its 5-CH3-THF and 5-CHO-THF derivatives, methotrexate (structural analogue of folic

acid), biopterin, AdoMet and its structural analog sinefungin, thiamine, pyrimidine and

ATP. These studies would allow to determine the plasma membrane and mitochondrial

transporters for metabolites essential in one carbon metabolism. It also remains of interest

to determine the function (the transported substrate) of the remaining plasma membrane

and intracellular FBTs.

154

Acknowledgments

This work was funded in part by the CIHR group and operating grants to M.O. A. A-O. is

the recipient of a CIHR studentship. M.O. is a Burroughs Wellcome Fund Scholar in

Molecular Parasitology and holds the Canada Research Chair in Antimicrobial Resistance.

References

(1) Murray, H.W., et al., Advances in leishmaniasis. Lancet, 2005(366): p. 1561-77. (2) Kedzierski, L., Y. Zhu, and E. Handman, Leishmania vaccines: progress and

problems. Parasitology, 2006. 133 Suppl: p. S87-112. (3) Croft, S.L., S. Sundar, and A.H. Fairlamb, Drug resistance in leishmaniasis. Clin

Microbiol Rev, 2006. 19: p. 111-26. (4) Ouellette, M., J. Drummelsmith, and B. Papadopoulou, Leishmaniasis: drugs in the

clinic, resistance and new developments. Drug Resist Update, 2004. 7: p. 257-66. (5) Nzila, A., et al., Comparative folate metabolism in humans and malaria parasites.

Part I. Pointers for malaria treatment from cancer chemotherapy. Trends Parasitol, 2005. 21: p. 292-8.

(6) Schweitzer, B.I., A.P. Dicker, and J.R. Bertino, Dihydrofolate reductase as a therapeutic target. FASEBJ1990. 4: p. 2441-52.

(7) Then, R.L., Antimicrobial dihydrofolate reductase inhibitors—achievements and future options: review. J Chemother, 2004.16(1): p. 3-12.

(8) Christensen, K.E. and R.E. MacKenzie, Mitochondrial one-carbon metabolism is adapted to the specific needs of yeast, plants and mammals. Bioessays, 2006. 28(6): p. 595-605.

(9) Fox, J.T. and P.J. Stover, Folate-mediated one-carbon metabolism. Vitam Horm, 2008. 79: p. 1-44.

(10) Tibbetts, A.S. and D.R. Appling, Compartmentalization of Mammalian folate-mediated one-carbon metabolism. Annu Rev Nutr, 2010. 30: p. 57-81.

(11) Ouellette, M., et al., Pterin transport and metabolism in Leishmania and related trypanosomatid parasites. Int J Parasitol. , 2002. 32(4): p. 385-98.

(12) Cunningham, M.L. and S.M. Beverley, Ptéridine salvage throughout the Leishmania infectious cycle: implications for antifolate chemotherapy. Mol Biochem Parasitol, 2001. 113(2): p. 199-213.

(13) Kundig, C , et al., Increased transport of ptéridines compensates for mutations in the high affinity folate transporter and contributes to methotrexate resistance in the protozoan parasite Leishmania tarentolae. EMBOJ. , 1999.18(9): p. 2342-51.

(14) Lemley, C, et al., The Leishmania donovani LD1 locus gene ORFG encodes a biopterin transporter (BTI). Mol Biochem Parasitol., 1999. 104(1): p. 93-105.

(15) Richard, D., C. Kûndig, and M. Ouellette, A new type of high affinity folic acid transporter in the protozoan parasite Leishmania and deletion of its gene in methotrexate-resistant cells. J Biol Chem., 2002. 277(33): p. 29460-7.

(16) Richard, D., et al., Growth phase regulation of the main folate transporter of Leishmania infantum and its role in methotrexate resistance. J Biol Chem., 2004. 279(52): p. 54494-501.

155

(17) Ouameur, A.A., et al., Functional analysis and complex gene rearrangements ofthe folate/biopterin transporter (FBT) gene family in the protozoan parasite Leishmania. Mol Biochem Parasitol., 2008.162(2): p. 155-64.

(18) Chang, A.B., et al., Phylogeny as a guide to structure and function of membrane transport proteins. MolMembr Biol, 2004. 21(3): p. 171-81.

(19) Saier, M.H., Jr., et al., The major facilitator superfamily. J Mol Microbiol Biotechnol, 1999. 1(2): p. 257-79. "

(20) Klaus, S.M., et al., Higher plant plastids and cyanobacteria have folate carriers related to those of trypanosomatids. J Biol Chem., 2005. 280(46): p. 38457-63.

(21) Dridi, L., A. Ahmed Ouameur, and M. Ouellette, High affinity S-Adenosylmethionine plasma membrane transporter of Leishmania is a member of the folate biopterin transporter (FBT) family. J Biol Chem., 2010. 285(26): p. 19767-75.

(22) Home, D.W., R.S. Holloway, and H.M. Said, Uptake of 5-formyltetrahydrofolate in isolated rat liver mitochondria is carrier-mediated. J Nutr., 1992. 122(11): p. 2204-9.

(23) Home, D.W., R.S. Holloway, and C. Wagner, Transport of S-adenosylmethionine in isolated rat liver mitochondria Arch Biochem Biophys., 1997. 343(2): p. 201-6.

(24) Ibar, C. and A. Orellana, The import of S-adenosylmethionine into the Golgi apparatus is required for the methylation of homogalacturonan. Plant Physiol, 2007. 145(2): p. 504-12.

(25) Ravanel, S., et al., Methionine metabolism in plants: chloroplasts are autonomous for de novo methionine synthesis and can import S-adenosylmethionine from the cytosol. J Biol Chem., 2004. 279.(21): p. 22548-57.

(26) Schwencke, J. and H. De Robichon-Szulmajster, The transport of S-adenosyl-L-methionine in isolated yeast vacuoles and spheroplasts. Eur J Biochem., 1976. 65(1): p. 49-60.

(27) Agrimi, G., et al., Identification of the human mitochondrial S-adenosylmethionine transporter: bacterial expression, reconstitution, functional characterization and tissue distribution. Biochem J. , 2004. 379(Pt 1): p. 183-90.

(28) McCarthy, E.A., et al., A mutation inactivating the mitochondrial inner membrane folate transporter creates a glycine requirement for survival of Chinese hamster cells. J Biol Chem., 2004. 279(32): p. 33829-36.

(29) Perchiniak, E., et al., Probing the mechanism of the hamster mitochondrial folate transporter by mutagenesis and homology modeling. Biochemistry, 2007 46(6): p. 1557-67.

(30) Titus, S.A. and R.G. Moran, Retrovirally mediated complementation of the glyB phénotype. Cloning of a human gene encoding the carrier for entry of folates into mitochondria J Biol Chem., 2000. 275(47): p. 36811-7.

(31) Marobbio, CM., et al., Identification and functional reconstitution of yeast mitochondrial carrier for 5-adenosylmethionine. EMBO J. , 2003. 22(22): p. 5975-82.

(32) Bedhomme, M., et al., Folate metabolism in plants: an Arabidopsis homolog of the mammalian mitochondrial folate transporter mediates folate import into chloroplasts. J Biol Chem., 2005. 280(41): p. 34823-31.

(33) Bouvier, F., et al., Arabidopsis SAMT1 defines a plastid transporter regulating plastid biogenesis and plant development Plant Cell, 2006. 18(11): p. 3088-105.

156

(34) Palmieri, L., et al., Molecular identification of an Arabidopsis S-adenosylmethionine transporter. Analysis of organ distribution, bacterial expression, reconstitution into liposomes, and functional characterizatioa Plant Physiol. , 2006b. 142(3): p. 855-65.

(35) Arco, A.D. and J. Satrùstegui, New mitochondrial carriers: an overview. Cell Mol Life Sci., 2005. 62(19-20): p. 2204-27.

(36) Palmieri, F., The mitochondrial transporter family (SLC25): physiological and pathological implications. Pflugers Arch., 2004. 447(5): p. 689-709.

(37) Palmieri, F., et al., Identification of mitochondrial carriers in Saccharomyces cerevisiae by transport assay of reconstituted recombinant proteins. Biochim Biophys Acta., 2006a. 1757(9-10): p. 1249-62.

(38) Picault, N., et al., The growing family of mitochondrial carriers in Arabidopsis. Trends Plant Sci., 2004. 9(3): p. 138-46.

(39) Palmieri, F. and CL. Pierri, Structure and function of mitochondrial carriers - role ofthe transmembrane helix P and G residues in the gating and transport mechanism. FEBSLett., 2010. 584(9): p. 1931-9.

(40) Colasante, C , et al., Mitochondrial carrier family inventory of Trypanosoma brucei brucei: Identification, expression and subcellular localisation. Mol Biochem Parasitol, 2009. 167(2): p. 104-17.

(41) Papadopoulou, B., G. Roy, and M. Ouellette, Frequent amplification of a short chain dehydrogenase gene as part of circular and linear amplicons in methotrexate resistant Leishmania. Nucleic Acids Res., 1993. 21(18): p. 4305-12.

(42) Kang, J. and D.C. Samuels, The evidence that the DNC (SLC25A19) is not the mitochondrial deoxyribonucleotide carrier. Mitochondrion, 2008. 8(2): p. 103-8.

(43) Marobbio, CM., et al., Identification and reconstitution of the yeast mitochondrial transporter for thiamine pyrophosphate. EMBO J. , 2002. 21(21): p. 5653-61.

(44) El Fadili, A., C Kundig, and M. Ouellette, Characterization of the folylpolyglutamate synthetase gene and polyglutamylation of folates in the protozoan parasite Leishmania. Mol Biochem Parasitol, 2002. 124(1-2): p. 63-71.

(45) Papadopoulou, B., G. Roy, and M. Ouellette, A novel antifolate resistance gene on the amplified H circle ofLeishmania. EMBOJ, 1992. 11(10): p. 3601-8.

(46) Trippett, T.M., et al., Localization of a human reduced folate carrier protein in the mitochondrial as well as the cell membrane of leukemia cells. Cancer Res., 2001. 61(5): p. 1941-7.

(47) Leroch, M., et al., Identification of a novel adenine nucleotide transporter in the endoplasmic reticulum of Arabidopsis. Plant Cell, 2008. 20(2): p. 438-51.

(48) Colasante, C , et al., Characterization and developmentally regulated localization of the mitochondrial carrier protein homologue MCP6 from Trypanosoma brucei. Eukaryot Cell, 2006. 5(8): p. 1194-205.

(49) Murta, S.M., et al., Methylene tétrahydrofolate dehydrogenase/cyclohydrolase and the synthesis of 10-CHO-THF are essential in Leishmania major. Mol Microbiol, 2009. 71(6): p. 1386-401.

(50) Opperdoes, F.R. and G.H. Coombs, Metabolism of Leishmania: proven and predicted. Trends Parasitol, 2007. 23(4): p. 149-58.

(51) Reguera, R.M., et al., S-Adenosylmethionine in protozoan parasites: functions, synthesis and regulatioa Mol Biochem Parasitol, 2007.152(1): p. 1-10.

157

(52) Vickers, T.J., et al., The enzymes of the 10-formyl-tetrahydrofolate synthetic pathway are found exclusively in the cytosol of the trypanosomatid parasite Leishmania major. Mol Biochem Parasitol, 2009. 166(2): p. 142-52.

(53) McConville, M.J., et al., Secretory pathway of trypanosomatid parasites. Microbiol Mol Biol Rev., 2002. 66(1): p. 122-54.

(54) Hirschberg, C.B., P.W. Robbins, and C Abeijon, Transporters of nucleotide sugars, ATP, and nucleotide sulfate in the endoplasmic reticulum and Golgi apparatus. Annu Rev Biochem., 1998. 67: p. 49-69.

(55) Visser, W.F., et al., Identification of human PMP34 as a peroxisomal ATP transporter. Biochem Biophys Res Commun., 2002. 299(3): p. 494-7.

(56) Haitina, T., et al., Fourteen novel human members of mitochondrial solute carrier family 25 (SLC25) widely expressed in the central nervous system. Genomics, 2006. 88(6): p. 779-90.

(57) Marobbio, CM., M.A. Di Noia, and F. Palmieri, Identification of a mitochondrial transporter for pyrimidine nucleotides in Saccharomyces cerevisiae: bacterial expression, reconstitution and functional characterization. Biochem J., 2006. 393(Pt 2): p. 441-6.

(58) Li, F.Y., et al., Characterization of a novel human putative mitochondrial transporter homologous to the yeast mitochondrial RNA splicing proteins 3 and 4. FEBSLett., 2001. 494(1-2): p. 79-84.

(59) Spaan, A.N., et al., Identification ofthe human mitochondrial FAD transporter and its potential role in multiple acyl-CoA dehydrogenase deficiency. Mol Genet Metab., 2005. 86(4): p. 441-7.

(60) Todisco, S., et al., Identification of the mitochondrial NAD+ transporter in Saccharomyces cerevisiae. J Biol Chem., 2006. 28(3): p. 1524-31.

(61) Palmieri, F., et al., Molecular identification and functional characterization of Arabidopsis thaliana mitochondrial and chloroplastic NAD+ carrier proteins. J Biol Chem., 2009. 284(45): p. 31249-59.

158

Table 1: Percentage identity (Id) and similarity (Sim) between Leishmania infantum mitochondrial carrier proteins (MCPs) with their human, yeast and plant homologs. The % Id/Sim values were obtained through NCBI-BLASTP analyses.

GeneDB Identity Human homolog Id/Sim (%) Yeast homolog Id/Sim

(%) Arabidopsis homolog Id/Sim (%)

LinJ15.0120 SLC25A33 (unknown) 27/44 YBRI92w(RIM2) 27/43 Atlg25380(AtNDT2) 26/48 LinJ19.1090 SLC25A19 (TPC) 27/46 YPROUc (unknown) 24/44 At2g37890 (unknown) 30/49 LinJ23.1630 SLC25A37 (MFRN) 23/42 YJL133w(MRS3) 23/40 At4g39460 (SAMC1/SAMT1) 25/40 LinJ32.0110 SLC25A26 (SAMC) 37/49 YNL003c (PET8/Sam5p) 36/48 At4g39460 (SAMC1/SAMT1) 32/45 LinJ32.1170 SLC25A32 (MFT) 26/46 YEL006w (NAD2) 25/49 At5g66380 (AtFOLTl) 27/49 LinJ32.U80 SLC25A32 (MFT) 24/42 YEL006W (NAD2) 24/43 At5g66380 (AtFOLTl) 28/44 LinJ35.3380 SLC25A17(PMP34) 28/47 YIL134w(FLXl) 22/48 At5g66380 (AtFOLTl) 31/46

Unknown, unknown function; PMP34, peroxisomal membrane protein (ATP transporter in human [55]); MFT, mitochondrial folate transporter [30]; TPC, mitochondrial thiamine pyrophosphate carrier [42]; MFRN, putative iron transporter [56]; SAMC, S-adenosylmethionine mitochondrial carrier protein [27]; RIM2, mitochondrial pyrimidine nucleotide transporter [57]; MRS3, iron transporter [58]; FLX1, mitochondrial flavin adenine dinucléotide (FAD) carrier [59]; PET8/Sam5p, S-adenosylmethionine mitochondrial carrier protein [31]; NAD2, mitochondrial nicotinamide adenine dinucléotide (NAD) transporter [60]; AtFOLTl, chloroplast folate transporter [32]; SAMC1/SAMT1, S-adenosylmethionine mitochondrial and chloroplast carrier proteins [33, 34]; AtNDT2, mitochondrial NAD transporter [61].

Figure Legends

Fig. 1. Structure of monoglutamate folate (F), biopterin (B) and S-adenosylmethionine

(AdoMet) and compartmentation of one-carbon metabolism in Leishmania. The

biosynthetic enzymes of the one-carbon metabolism are indicated by solid arrows. The

cellular and organellar transport systems are indicated by dotted arrows and question

marks. The names ofthe functionally characterized transporters are indicated in the circles.

pABA, j?-aminobenzoic acid; FT1 and FT5, folate transporters; BTI, biopterin transporter;

AdoMetTl, S-adenosylmethionine transporter 1; DHF, dihydrofolate; THF,

tétrahydrofolate; BH2, dihydrobiopterin; BH4, tetrahydrobiopterin; THF-Glun,

tétrahydrofolate polyglutamate; 5,10-CH2-THF, 5,10-Methylene-tetrahydrofolate; FA,

Folic acid; IO-CH3-THF, 10-Methyl-Tetrahydrofolate; 10-CHO-THF, 10-Formyl-

tetrahydrofolate

Fig. 2. Subcellular localization of FBT-GFP fusions in Leishmania. Promastigote cells

overexpressing GFP (pSPaNEOct-GFP) or FBT-GFP fusion proteins were visualised by

epifluorescence microscopy after 48 hours of growth following transfection. Because there

are two identical copies ofthe gene LinJl 0.1450, the localization of 13 (rather than 14)

FBT proteins are shown. The fusion constructs LinJ04.0020-GFP, LinJ06.0310-GFP and

159

LinJl0.0360-GFP were transfected in both L. infantum wild-type (strain

MHOM/MA/67/ITMAP-263) and the methotrexate resistant mutant L. tarentolae

TarMTXl000.6 and showed the same intracellular localization. For these three fusions,

only the expression patterns observed in L. infantum is shown. All other FBT-GFP

constructs were transfected in TarMTXl000.6 promastigote cells only whereas

LinJ35.5120 was solely transfected in L. infantum. DIC, differencial interference contrast;

GFP, fluorescence of GFP; Merge, overlaid of GFP and DIC images.

Fig. 3. Mitochondrial localization of MCP-GFP fusions in Leishmania. Leishmania

infantum promastigote cells overexpressing GFP (pSP aNEOa-GFP) or MCP-GFP fusion

proteins were visualised by epifluorescence microscopy after 48 hours of growth following

transfection. The MitoTracker Red CMXRos (20 nM) was used to locate the mitochondrion

in the cells. The same cells were photographed first with a MitoTracker Red filter followed

by the GFP filter and then with the phase-contrast (DIC) filter. DIC, differencial

interference contrast; GFP, fluorescence of GFP; MitoTracker, fluorescence of MitoTracker

Red CMXRos; Merge A, overlaid of the MitoTracker Red images with the GFP images;

Merge B; overlaid ofthe DIC images with the GFP and mitoTracker fluorescence images.

160

Folate (F)

Biopterin (B)

Pterin

Glutamate

o/^~ COOH

HN-CH-CH,-CH,-COOH

NH,

HOOC

S-adenosylmethionine (AdoMet)

OH OH

Fig.l

161

DIC GFP Merge

pSPaNEOu-GFP 5 Lin J 04.0021)

5

LM06.0310

5

i

LM06.1320

5

LinJ 10.0360

5

LinJlO.0370 (AdoMetTl)

5

LinJlO.0370 (AdoMetTl)

5

U LinJ10.0380

5

" LinJ 10.0390

5

"

LinJlO.0400 (FT1)

5

LinJlO.0400 (FT1)

_ LinJ 10.0410

_ LinJl 0.0420 (FT5)

_ LinJl 0.0420 (FT5)

LinJl0.1450

LinJ19.0870

LinJ3S.5120 (BTI)

Fig. 2

162

DIC GFP Merge DIC GFP

A B

pSPaNEOa-GFP ^ 4 •« >

LM32.1170 4%

>

LinJn.l l HO J J +

LinJ35.3380 ■4

V f*

LinJ32.0110 r

i LinJ 19.1090

K r r

r

i

Fig. 3

163

Supplementary material

Table SI: Forward (FW) and reverse (RV) primers for all FBT family genes and five selected members ofthe MC family ofLeishmania infantum.

Family protein GeneDB systematic name Sequence (5' => 3') References

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ04.0020

FW1 CGTCTAGAGCGTCATCATGACGG

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ04.0020

FW1

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ04.0020 RV1 GCAAGCTTTCAAGATGCCTGGCT

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ04.0020 FW2 CGAGATCTGCGTCATCATGACGG

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ04.0020 FW2

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ04.0020

RV2 GCTCTAGAAGATGCCTGGCTCAAC

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ04.0020

RV2

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ06.0310

FW1 TCTAGAATGGCGGCCAACTACCGAG

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ06.0310

FW1

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ06.0310 RV1 CTAAGCTTTTATGGAGGCAACTC

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ06.0310 RV1

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ06.0310 FW2 TCGGATCCCCTGCAGCCATGGCG

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ06.0310 FW2

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ06.0310

RV2 CGTCTAGATGGAGGCAACTCGTTAATCGG

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ06.0310

RV2

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ06.1320

FW1 TTCTAGATTTCCCATGGCGTCCGC

This work 1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ06.1320 RV1 GCAAGCTTCCTCCTCAGGCCTTTGG

This work 1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ06.1320 RV1

This work 1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ06.1320 FW2 GGATCCCATGGCGTCCGCACAT

This work 1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ06.1320 FW2

This work 1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ06.1320

RV2 ATTCCTCTAGAGGC<CTTTGGCTCC

This work 1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ06.1320

RV2

This work 1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJlO.0360

FW1 CCTCTAGACAGCGACGATGGCTG

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJlO.0360

FW1

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJlO.0360 RV1 GGTCGACTCATTTCACGACCCTC

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJlO.0360 FW2 CGGATCCAGCGACGATGGCTGAAT

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJlO.0360 FW2

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJlO.0360

RV2 GCTCTAGATTTCACGACCCTCCGTAC

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJlO.0370 (AdoMetTl)

FW1 TTCTAGAAGCCCAGAATGGCGAAGGGT

1

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJlO.0370 (AdoMetTl)

FW1

1

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJlO.0370 (AdoMetTl) RV1 AAGCTTGCGCTAGACCTTCTCTCGCGT

1

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJlO.0370 (AdoMetTl) RV1

1

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJlO.0370 (AdoMetTl) FW2 GGATCCAGCCCAGAATGGCGAAG

1

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJlO.0370 (AdoMetTl) FW2

1

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJlO.0370 (AdoMetTl)

RV2 CAATCCTCTAGAGACCTTCTCTCGCGTCG

1

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJlO.0370 (AdoMetTl)

RV2

1

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJlO.0380

FW1 TTCTAGACGCACATGACACGCTCA

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJlO.0380

FW1

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJlO.0380 RV1 AAAGCTTACCTTACAAGTGGCCCTT

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJlO.0380 RV1

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJlO.0380 FW2 GGGATCCCGCACATGACACGCTCAC

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJlO.0380 FW2

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJlO.0380

RV2 TTCTAGACAAGTGGCCCTTTGGCG

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJlO.0380

RV2

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ10.0390a

FWI CGTCTAGAGTGAAGTCGAACCATGTCC

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ10.0390a

FWI

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ10.0390a RV1

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ10.0390a RV1 CGAAGCTTCTACTCCTTTTTATGCGTCTGC

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ10.0390a RV1

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ10.0390a

FW2 CGGGATCCGTGAAGTCGAACCATGTCC This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ10.0390a

FW2 This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ10.0390a

RV2 CGTCTAGACTCCTTTTTATGCGTCTGCGC

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ10.0390a

RV2

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to LinJ10.0400(FTl)

FWI GCTCTAGACCATTGCCATCAGCATGTCC

2

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to LinJ10.0400(FTl)

FWI

2

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to LinJ10.0400(FTl) RV1 GCAAGCTTGCTATTTCTCTGAAGCG

2

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to LinJ10.0400(FTl) RV1

2

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to LinJ10.0400(FTl) FW2 GCTCTAGACCATTGCCATCAGCATGTCC

2

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to LinJ10.0400(FTl) FW2

2

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to LinJ10.0400(FTl)

RV2 GGAATTCTTCTTCTGAAGCGCCCGCCC

2

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to LinJ10.0400(FTl)

RV2

2

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ 10.0410

FWI TTCTAGAACACCTTACCACGATGTCC

3

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ 10.0410

FWI

3

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ 10.0410 RV1 AAAGCTTGCTTCACGCGTTGCC

3

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ 10.0410 RV1

3

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ 10.0410 FW2 GGGATCCCCTTACCACGATGTCC

3

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ 10.0410 FW2

3

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ 10.0410

RV2 TTCTAGACGCGTTGCCCTGCAC

3

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ 10.0410

RV2

3

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ 10.0420 (FT5)b FWI TCTAGAAGTGCCCATGGATGCGGCAC This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ 10.0420 (FT5)b FWI This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ 10.0420 (FT5)b

RV1 AAGCTTCCCCACGCCTCACGCGCGCTT

This work

1 03

H pq LU

u

t; o a d ea u

H a •s a, o

CQ ■a a es eu

• 4 —

ea ^^ o

to

LinJ 10.0420 (FT5)b

RV1

This work

164

•

FW2 CGGATCCAGTGCCCATGGATGCGGCAC

•

FW2

•

RV2 CGTCTAGACGCGCGCTTCCTCTCTGCTTGC

•

RV2

•

LinJlO.1450

FWI TTCTAGAAGCGACCATGACCGTTGGT

This work

•

LinJlO.1450

FWI

This work

•

LinJlO.1450 RV1 AAGCTTGACGACTACTGCTGCCCCT

This work

•

LinJlO.1450 RV1

This work

•

LinJlO.1450 FW2 CGGATCCAGCGACCATGACCGTTG

This work

•

LinJlO.1450 FW2

This work

•

LinJlO.1450

RV2 CGTCTAGACTGCTGCCCCTCCGAATC

This work

•

LinJlO.1450

RV2

This work

• LinJ19.0870

FWI TTCTAGAGAACTAGCAATGACGTTAGAG

3 • LinJ19.0870

FWI

3 • LinJ19.0870 RV1 GGTCGACTCCTTGTTCAATGCTTGCC

3 • LinJ19.0870 RV1

3 • LinJ19.0870 FW2 GGATCCGAACTAGCAATGACGTTAGAG

3 • LinJ19.0870 FW2

3 • LinJ19.0870

RV2 TCCTTCTAGAATGCTTGCCGGC

3 • LinJ19.0870

RV2

3 •

LinJ35.5120(BTl)c

FWI GCTCTAGATTGCCATCATGCCAGGTCGT

This work

•

LinJ35.5120(BTl)c

FWI

This work

•

LinJ35.5120(BTl)c RV1 AAGCTTAATTCGCTAGCTGTCCCGCCTCAT

This work

•

LinJ35.5120(BTl)c RV1

This work

•

LinJ35.5120(BTl)c

FW2 CGGGATCCTTGCCATCATGCCAGG This work

•

LinJ35.5120(BTl)c

FW2 This work

•

LinJ35.5120(BTl)c

RV2 CGTCTAGAGCTGTCCCGCCTCATTGTCG

This work

•

LinJ35.5120(BTl)c

RV2

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ 19.1090

FWI CGTCTAGACTGTCGATGTCCAGC

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ 19.1090

FWI

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ 19.1090 RV1 CGTCGACTCAAGGACCCTTCTTCC

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ 19.1090 RV1

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ 19.1090 FW2 CGGATCCCTGTCGATGTCCAGC

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ 19.1090 FW2

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ 19.1090

RV2 CGTCTAGAAGGACCCTTCTTCCGC

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ 19.1090

RV2

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ32.0110

FWI CTCTAGAGTGTAGATCGTATGGAGTCGC

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ32.0110

FWI

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ32.0110 RV1 CGAAGCTTCTATAGCGTGTGCTCGC

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ32.0110 RV1

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ32.0110 FW2 CGGATCCGTGTAGATCGTATGGAGTCG

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ32.0110 FW2

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ32.0110

RV2 CGTCTAGATAGCGTGTGCTCGCTTTG

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ32.0110

RV2

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ32.1170

FWI CCTCTAGAGATCTCCATGAATAAGTTAAGCG

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ32.1170

FWI

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ32.1170 RV1 CTAAGCTTCTACGACGACGGATATCGCC

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ32.1170 RV1

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ32.1170 FW2 CCGGATCCGATCTCCATGAATAAGTTA

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ32.1170 FW2

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ32.1170

RV2 CTTCTAGACGACGACGGATATCGCC

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ32.1170

RV2

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ32.1180

FWI CGTCTAGATTGCCATGGCGGAG

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ32.1180

FWI

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ32.1180 RV1 AAGCTTTCAGGGCAAGATGTGCTG

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ32.1180 FW2 GGGATCCTTGCCATGGCGGAG This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ32.1180 FW2 This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ32.1180

RV2 GTTTCTAGAGGGCAAGATGTGCTGTGC

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ32.1180

RV2

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ35.3380

FWI CGTCTAGATTCGCCATGACGAAAGC

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ35.3380

FWI

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ35.3380 RV1 GTGTCGACCTACTGAAACTGAGGC

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ35.3380 RV1

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ35.3380 FW2 CGGATCCTTCGCCATGACGAAAG

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ35.3380 FW2

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ35.3380

RV2 GTTCTAGACTGAAACTGAGGCTTTCCCAC

This work

o

93 to u cu •c u 93 U 93 "C is a © JS u o

LinJ35.3380

RV2

This work

The primer pairs FW1/RV1 were used to clone the wild-type gene while the primer pairs FW2/RV2 were used for in-frame cloning with C-terminal green fluorescent protein (GFP) tag. Restriction sites are underlined. Start and stop codons and anticodons are in bold. a, this gene is absent in strain MHOM/MA/67/ITMAP-263 ((3) and data not shown) and was amplified from strain JPCM5. and c, these genes are the orthologs of the L. tarentolae folic acid transporter FT5 and L. mexicana biopterin transporter BTI, respectively (3).

165

Fig. SI. Phylogenetic tree of the Leishmania infantum mitochondrial carrier family

(MCF) proteins. The amino acid sequences of the 32 MCF proteins of L. infantum were

aligned with the 46 human (SLC25A) MCF proteins (4, 5), the functionally characterised

organellar Arabidopsis thaliana (At) folate and AdoMet transporters and yeast (Y) thiamine

and AdoMet transporters (6-10). The tree was constructed using MEGA4.1 software (11).

The Neighbor-Joining method (12) was used with Poisson correction, complete deletion of

gap and 1000 bootstrap replicates. Bootstrap values equal or above 55% were indicated at

the relevant nodes. The dark gray surfaces are used to mark the major functional MCF

subgroups. The scale bar represents 10 substitutions per 100 sites.

166

Accession numbers

The accession numbers ofthe 32 L. infantum MCF proteins (LinJ) are given in Figure SI.

The accession number of the 46 members of the human MCF (SLC25A) proteins, and the

selected functionally characterized yeast (Y) and plant (At) mitochondrial carrier proteins

are : SLC25A1 (P53007), SLC25A2 (Q9BXI2), SLC25A3 (Q00325), SLC25A4 (P12235),

SLC25A5 (P05141), SLC25A6 (P12236), SLC25A7 (P25874), SLC25A8 (P55851),

SLC25A9 (P55916), SLC25A10 (Q9UBX3), SLC25A11 (Q02978), SLC25A12 (075746),

SLC25A13 (Q9UJS0), SLC25A14 (095258), SLC25A15 (Q9Y619), SLC25A16 (P16260),

SLC25A17 (043808), SLC25A18 (Q9H1K4), SLC25A19 (Q9HC21), SLC25A20

(043772), SLC25A21 (Q9BQT8), SLC25A22 (Q9H936), SLC25A23 (Q9BV35),

SLC25A24 (Q6NUK1), SLC25A25 (Q6KCM7), SLC25A26 (Q70HW3), SLC25A27

(095847), SLC25A28 (Q96A46), SLC25A29 (Q8N8R3), SLC25A30 (Q5SVS4),

SLC25A31 (Q9H0C2), SLC25A32 (Q9H2D1), SLC25A33 (Q9BSK2), SLC25A34

(Q6PIV7), SLC25A35 (Q3KQZ1), SLC25A36 (Q96CQ1), SLC25A37 (Q9NYZ2),

SLC25A38 (Q96DW6), SLC25A39 (Q9BZJ4), SLC25A40 (Q8TBP6), SLC25A41

(Q8N5S1), SLC25A42 (Q86VD7), SLC25A43 (Q8WUT9), SLC25A44 (Q96H78),

SLC25A45 (Q8N413), SLC25A46 (Q96AG3), YGR096w (AAT93128), YNL003c

(P38921), YEL006w (DAA07645), YIL006W (P40556), At5g66380 (Q4A3R4),

At4g39460 (Q94AG6), Atlg34065 (NP_564436).

References

(1) Dridi, L., A. Ahmed Ouameur, and M. Ouellette, High affinity S-Adenosylmethionine plasma membrane transporter of Leishmania is a member of the folate biopterin transporter (FBT) family. J Biol Chem., 2010. 285(26): p. 19767-75.

(2) Richard, D., et al., Growth phase regulation of the main folate transporter of Leishmania infantum and its role in methotrexate resistance. J Biol Chem., 2004. 279(52): p. 54494-501.

(3) Ouameur, A.A., et al., Functional analysis and complex gene rearrangements ofthe folate/biopterin transporter (FBT) gene family in the protozoan parasite Leishmania. Mol Biochem Parasitol, 2008. 162(2): p. 155-64.

(4) Arco, A.D. and J. Satrustegui, New mitochondrial carriers: an overview. Cell Mol Life Sci., 2005. 62(19-20): p. 2204-27.

(5) Palmieri, F., The mitochondrial transporter family (SLC25): physiological and pathological implications. Pflugers Arch, 2004. 447(5): p. 689-709.

167

(6) Bedhomme, M., et al., Folate metabolism in plants: an Arabidopsis homolog of the mammalian mitochondrial folate transporter mediates folate import into chloroplasts. J Biol Chem., 2005. 280(41): p. 34823-31.

(7) Bouvier, F., et al., Arabidopsis SAMT1 defines a plastid transporter regulating plastid biogenesis and plant development Plant Cell, 2006. 18(11): p. 3088-105.

(8) Kang, J. and D.C. Samuels, The evidence that the DNC (SLC25A19) is not the mitochondrial deoxyribonucleotide carrier. Mitochondrion, 2008. 8(2): p. 103-8.

(9) Marobbio, CM., et al., Identification and functional reconstitution of yeast mitochondrial carrier for 5-adenosylmethionine. EMBO J., 2003. 22(22): p. 5975-82.

(10) Marobbio, CM., et al., Identification and reconstitution of the yeast mitochondrial transporter for thiamine pyrophosphate. EMBOJ., 2002. 21(21): p. 5653-61.

(11) Tamura, K., et al., MEGA4: Molecular Evolutionary Genetics Analysis (MEGA) software version 4.0. Molecular Biology and Evolution, 2007. 24: p. 1596-1599.

(12) Saitou, N. and M. Nei, The neighbor-joining method: a new method for reconstructing phylogenetic trees. Mol Biol EvoL, 1987. 4: p. 406-25.

168

CHAPITRE V. CONCLUSION GÉNÉRALE

5.1 Discussion

Les molécules utilisées pour traiter la leishmaniose sont limitées et plusieurs

problèmes sont associés à leurs utilisations tel le coût élevé du traitement, la toxicité et

l'émergence des phénomènes de résistance à travers le monde, principalement aux

composés à base d'antimoine qui constituent les molécules de première ligne de défense

depuis plus de 50 ans. Identifier de nouvelles cibles thérapeutiques pour développer des

nouveaux médicaments est donc capital. Suite à la découverte des antifolates et de leur

succès dans le traitement des infections microbiennes comme celles causées par le parasite

Plasmodium, l'agent étiologique de la malaria, les chercheurs se sont intéressés au

métabolisme des folates du parasite Leishmania dans le but de comprendre ses

particularités et de trouver des cibles thérapeutiques potentielles (136, 246, 259).

Le parasite Leishmania, comme les autres parasites de la famille des

Trypanosomatidae, est auxotrophe pour les ptéridines (ptérines et folates) et a donc

développé un système de transport qui lui permet d'importer activement ces cofacteurs du

milieu environnant. Trois protéines, BTI, FT1 et FT5 sont impliquées dans cette activité.

BT1 a été isolé par clonage fonctionnel chez L. donovani (188) et chez L. tarentolae (179)

et correspond au principal transporteur de la bioptérine. Il permet aussi de transporter

l'acide folique avec une faible capacité, mais est incapable de transporter le methotrexate

(179). FT5, isolé chez L. tarentolae, est un transporteur d'acide folique de très haute

affinité (Km= 84 nM), mais de faible capacité (311), tandis que FT1 correspond au

transporteur principal d'acide folique (Km= 410 nM) chez L. infantum et L. donovani (73,

312). FT1 et FT5 transportent aussi l'antifolate methotrexate et la perte de ces deux

transporteurs conduit à la résistance de ce composé toxique (311, 312, 384). La découverte

de ces trois protéines est à l'origine d'une nouvelle classe de transporteurs nommée la

famille des transporteurs de folate et de la bioptérine (FBT). Le génome de L. infantum

code pour 13 protéines différentes appartenant à cette famille, mais la fonction de la plupart

d'entre elles reste inconnue. Caractériser la fonction de ces transporteurs paraît donc

169

essentiel afin de comprendre leurs rôles respectifs dans le métabolisme et la physiologie du

parasite.

Cette caractérisation est également importante pour la découverte de nouvelles

cibles tftérapeutiques et, à travers elles, la possibilité de développer de nouveaux

médicaments contre la leishmaniose. En effet, l'importance du transport de nutriments

essentiels pour la viabilité des parasites laisse croire que l'inhibition de cette activité

pourrait constituer une stratégie thérapeutique efficace. Un exemple d'une telle approche

vient des études sur le paludisme, où des efforts sont déjà en cours pour développer des

inhibiteurs du transporteur d'hexoses chez Plasmonium falciparum. En effet, un des

composés inhibant sélectivement ce transporteur a montré une activité anti-Plasmodium in

vitro et in vivo et a permis de le désigner comme une nouvelle cible thérapeutique (155,

331). Les transporteurs peuvent aussi être exploités pour véhiculer des molécules toxiques à

l'intérieur de la cellule (184). L'existence de tels transporteurs a été démontrée pour

plusieurs molécules antiparasitaires actuellement en cours d'utilisation en clinique telles la

pentamidine, la miltefosine et l'allopurinol (184). Il est donc primordial de connaître la

fonction de tous les autres membres de la famille FBT afin de mettre en place une stratégie

thérapeutique efficace qui exploite ces transporteurs.

Chapitre II. Analyse fonctionnelle et réarrangements géniques complexes des gènes de la famille des transporteurs de folate et de la bioptérine (FBT) chez le parasite protozoaire Leishmania

Multiplicité de la famille FBT

Le séquençage du génome de L. infantum (souche JPCM5) et de L. major (souche

Friedlin) (www.genedb.org) a facilité l'identification des gènes codant pour les protéines de

la famille FBT. Au total, il y a 14 gènes FBT chez L. infantum et 13 (plus un pseudogène;

LmjFl0.0350) chez L. major. La présence de deux copies identiques d'un gène FBT limite

ainsi la famille FBT à 13 membres chez L. infantum et à 12 membres chez L. major. Une

particularité intéressante de l'organisation génomique des gènes FBT chez Leishmania est

la présence sur un même locus de 7 gènes FBT (dont FT1 et FT5) organisés en tandem, ce

170

qui suggère un historique d'événements de duplication génique. Cette hypothèse est

renforcée par le fait que ces protéines partagent une forte homologie de séquence (e.g. il y a

entre 50% et 97% de similarité entre les 13 protéines FBT de L. infantum). La duplication

de gène est un moyen d'évolution particulièrement efficace puisque l'un des gènes

dupliqués peut évoluer vers une nouvelle fonction par sélection naturelle. LmjF 10.0350 est

un pseudogène chez L. major mais pas son orthologue (LinJlO.0360) chez L. infantum. On

ne sait pas encore si LinJ 10.0360 code pour une protéine fonctionnelle, mais si c'est le cas,

il est possible qu'il confère un nouveau phénotype (jusqu'à présent inconnu) chez L.

infantum qu'on ne retrouve pas chez L. major. Le gène LinJlO.0390 semble être absent

chez la souche de L. infantum (MHOM/MA/67/ITMAP-263) étudiée dans ce projet. Des

analyses par Southern blot et par PCR nous ont permis de constater que LinJ 10.0390 est

absent chez MHOM/MA/67/ITMAP-263, mais est présent chez JPCM5 (résultats non

publiés). La culture in vitro de ces deux souches a permis d'observer que la souche

MHOM/MA/67/ITMAP-263 croît plus rapidement que la souche JPCM5. De plus, JPCM5

est plus résistante au methotrexate (MTX) (un analogue de l'acide folique)

comparativement à MHOM/MA/67/ITMAP-263. Ainsi, il faudrait vérifier si LinJlO.0390

correspond à un système d'efflux de folate et cela en déterminant l'impact de la

surexpression ou de la deletion de ce transporteur sur la résistance au MTX.

L'analyse de banques de données de protéines en utilisant la séquence de BT1 ou de

FT1 comme séquence référence a permis d'identifier plusieurs homologues. Ainsi, la

famille FBT est constituée de membres retrouvés uniquement chez des parasites

protozoaires, chez les cyanobactéries et chez les plantes supérieures. Il faut préciser que la

fonction de la plupart de ces transporteurs est inconnue. En effet, les seuls transporteurs de

fonction connue sont FT1, FT5, BT1 de Leishmania, At2g32040 d'Arabidopsis thaliana et

son orthologue slr0642 de la cyanobactérie Synechocystis. Les deux dernières protéines

correspondent aux transporteurs de folates monoglutamylés (169). L'analyse phylogénique

n'a malheureusement révélé aucun orthologue entre Leishmania et les autres organismes

analysés. En effet, la présence d'orthologues indiquerait qu'un FBT donné peut avoir une

fonction similaire entre les différents organismes, ce qui nous aiderait à caractériser cette

protéine chez Leishmania. Par ailleurs, la comparaison des protéines FBT de Leishmania

171

avec celles des Trypanosoma a révélé que la famille FBT a subi une expansion chez

Leishmania après la divergence évolutive de ces deux genres. Cette observation corrèle

avec une analyse génomique qui a démontré que les protéines du système de transport

semblent évoluer plus rapidement chez L. major comparativement à T. brucei (90). Cette

différence au niveau des protéines FBT entre les deux parasites pourrait résulter des

différentes niches qu'ils occupent dans leur hôte et de leurs besoins différents en

nutriments.

Profil d'expression de la famille FBT à la recherche de nouvelles fonctions

L'analyse du profil d'expression de la famille FBT chez Leishmania par TaqMan

RT-PCR en temps réel est une stratégie utilisée pour identifier des gènes exprimés de façon

différentielle, ce qui permet de fournir des indices quant à leur fonction ou leur rôle dans la

biologie du parasite. Nous étions particulièrement intéressés à identifier des gènes exprimés

préférentiellement au stade intracellulaire (amastigote) du parasite Leishmania. Nous avons

observé que l'expression d'un gène (LinJl0.0410) était de 2 à 3 fois plus élevé chez les

amastigotes en phase logarithmique de croissance, comparativement aux promastigotes. Il

serait donc intéressant de confirmer par d'autres analyses si ce transporteur est bel et bien

amastigote-spécifique afin de caractériser sa fonction et de déterminer s'il est essentiel à la

survie du parasite dans le phagolysozome. Par ailleurs, des études de transport effectuées

sur LinJ 10.0410 ont démontré qu'il ne transportait pas les folates à pH physiologique. Si

LinJ 10.0410 est spécifique aux amastigotes cela indiquerait que son activité de transport est

primordiale à pH plus acide, une hypothèse qui pourrait être vérifiée en faisant des études

de transport chez les amastigotes surexprimant ce transporteur.

L'expression de plusieurs gènes FBT (particulièrement LinJ06.1320,

LinJ10.0380, LinJlO.1450, LinJ19.0870) est préférentiellement exprimée en phase

stationnaire de croissance. Le fait que le transport de folate est très réduit chez les parasites

en phase stationnaire de croissance suggère que les transporteurs préférentiellement

exprimés dans cette phase de croissance ne transportent pas les folates. Néanmoins, il

faudrait d'abord confirmer si les niveaux des transcrits sont corrélés avec l'expression de la

protéine, ce qui n'est pas toujours le cas chez le parasite Leishmania (73, 182, 223). Par

contre, nous avons démontré par des études de transport et par des expériences de courbes

172

de croissance que ces protéines ne transportaient pas les folates. Ces résultats

impliqueraient donc un nouveau rôle de ces transporteurs FBT dans le métabolisme du

parasite (Chapitres III et IV).

Régulation développementale et adaptative de l'expression de FT1

En raison du rôle des folates dans la synthèse de l'ADN, il est connu que le

transport de ces cofacteurs est plus élevé chez des parasites en phase logarithmique de

croissance comparativement aux parasites en phase stationnaire où le transport chute

drastiquement (73, 93, 312). En corrélation avec ce constat, nous avons observé que seule

l'expression de FT1 (LinJl0.0400), le principal transporteur de folate (73, 312), a été

trouvée maximale dans la phase logarithmique de croissance. Chez Leishmania, la

régulation de l'expression génique s'effectue au niveau post-transcriptionel et implique

surtout des séquences situées dans la région 3' non-traduite (3'UTR) des gènes (63, 64).

Récemment, deux grandes familles nommées SIDER1 et SIDER2 (Short Interspersed

DEgenerated Retroposons), de courts rétroposons éteints situés presqu'exclusivement dans

les régions 3'UTRs des transcrits, ont été découvertes chez Leishmania (A3, 235). Il a été

observé que les gènes contenant l'élément SIDER2 sont en général faiblement exprimés

comparativement à ceux ne le contenant pas (43, 235). Ces résultats suggèrent la possibilité

que SIDER2 soit potentiellement impliqué dans la régulation développementale des gènes

en dégradant les transcrits (43, 235). L'analyse de la région 3' non-traduite (3'UTR) de FT1

a révélé la présence d'un rétroposon de type SIDER2. Il serait donc intéressant de

déterminer si cet élément joue un rôle dans la régulation développementale de FT1. Ceci

pourrait se faire par exemple en clonant la région 3'UTR contenant SIDER2 en C-terminal

d'un gène rapporteur codant pour la luciférase (LUC) et de vérifier si cela induit une

accumulation des niveaux du transcrit de LUC en phase logarithmique de croissance

comparativement à la phase stationnaire.

L'activité du transport de folate chez Leishmania est également modulée en fonction

des niveaux de folates dans le milieu de culture. En effet, l'incubation des cellules dans un

milieu pauvre en folates augmente fortement l'activité du transport chez celles-ci

comparativement aux cellules maintenues dans un milieu riche en folates (93). Nous avons

constaté que l'expression de FT1 est plus élevée lorsque les niveaux des folates dans le

173

milieu de culture sont faibles. Cette régulation peut être considérée comme une réponse

adaptative aux concentrations extérieures de folate et impliquerait l'existence de

mécanisme(s) contrôlant l'expression du transporteur. Ceci permettrait ainsi d'augmenter la

capacité du parasite à importer les folates lorsqu'ils sont présents en quantité limitée dans le

milieu extérieur. Un phénomène similaire a également été observé pour les transporteurs de

folates chez les mammifères et chez C. elegans (10, 21, 327, 362). Leishmania est un

organisme auxotrophe pour les purines et il est également soumis à une régulation

adaptative de ces transporteurs de nucléobases afin de maximiser le transport de ces

nutriments lorsqu'ils sont présents en faibles quantités (52, 257). Les mécanismes qui

gouvernent l'adaptation à une carence en folates (ou en purines) n'ont pas encore été

définis chez les trypanosomatides. La découverte de SIDER2 dans le 3'UTR de FT1

suggère la possibilité que cet élément joue également un rôle dans la régulation adaptative

du transporteur FT1.

Globalement, ces résultats démontrent l'importance de la régulation de l'expression

du principal transporteur de folate FT1 pour le développement du parasite et pour s'adapter

aux différentes concentrations de folate dans le milieu de culture.

Modulation de l'expression de FT1 en présence de l'antifolate methotrexate

La réduction du transport du MTX est un moyen de résistance fréquemment

remarqué chez Leishmania (95, 159, 271). Chez des mutants résistants aux MTX montrant

une suppression complète de l'entrée de l'inhibiteur, un réarrangement génique au niveau

des transporteurs de la famille FBT menant à la deletion des transporteurs de folate/MTX a

été constaté chez plusieurs espèces de Leishmania (311, 312, 384). Chez un mutant de L.

tarentolae hautement résistant au MTX (TarMTXl 000.6), dont l'influx de folate est

sévèrement réduit, la surexpression du transporteur de la bioptérine BT1 a été observé

(179). Grâce à la surexpression de BT1, le parasite peut transporter avec une faible capacité

le folate, mais pas le MTX (179). Ainsi, les cellules dont le système de transport de folate

est fortement réduit surexpriment BT1 et arrivent à importer suffisamment de folate pour

répondre à leur besoin malgré la présence du MTX.

174

L'analyse du profil d'expression de la famille FBT chez des mutants de L. infantum

résistants au MTX nous a permis de comprendre comment le parasite module l'expression

de certains transporteurs de cette famille afin d'empêcher le MTX d'entrer à l'intérieur de

la cellule. En effet, nos résultats montrent qu'en présence du MTX, le parasite module

l'expression de FT1 en utilisant des événements de recombinaison génique menant à un

réarrangement au niveau de FT1. Dans une étude menée en parallèle dans notre laboratoire

chez un mutant de L. major résistant au MTX, il a été observé que la modulation de

l'expression de FT1 résulte également des événements de recombinaison génique

conduisant à la deletion de celui-ci (311, 312, 384). Nous avons aussi confirmé la

surexpression de BT1 chez ces mutants, démontrant ainsi le rôle important de ce

transporteur comme moyen de compensation à l'inactivation du système primaire du

transport de folate. Le fait que FT1 est situé sur un locus avec 6 autres gènes FBT organisés

en tandem semble faciliter la sélection des événements de recombinaison génique

impliquant les séquences conservées de ces gènes. Ces recombinaisons géniques peuvent

être importantes pour moduler la fonction des gènes situés en tandem sur le chromosome.

Par exemple, il est possible que la chimère LinJ 10.03 80/0400 engendrée suite à la

recombinaison homologue entre les séquences conservées de FT1 et de LinJl 0.0380 que

nous avons mis en évidence soit fonctionnelle et qu'elle transporte des molécules

différentes de l'acide folique.

En conclusion, la famille FBT est une nouvelle classe de protéines membranaires

retrouvées chez les cyanobactéries, chez les parasites protozoaires et chez les plantes. Nous

avons élaboré une approche par TaqMan RT-PCR en temps réel afin de déterminer le profil

d'expression de chacun des 13 transporteurs de la famille FBT de Leishmania. Cette étude

nous a permis de constater que malgré leur forte homologie de séquence, les membres de

cette famille semblent avoir des fonctions différentes. Ceci est en corrélation avec le fait

que plusieurs gènes FBT sont préférentiellement exprimés en phase stationnaire de

croissance où le transport de folate est très faible. Des études dans notre laboratoire sont en

cours (Chapitre IV) afin de déterminer la fonction des autres membres de la famille FBT.

175

Chapitre III. Le transporteur de la 5-adénosylméthionine de haute affinité localisé au niveau de la membrane plasmique du parasite Leishmania est un membre de la famille des transporteurs de folate et de la bioptérine (FBT)

Identification et caractérisation du transporteur de la .S'-adénos\[methionine

(AdoMet) chez Leishmania

L'existence d'un transporteur commun pour l'AdoMet et la sinéfungine (SNF), son

analogue structural, a été suggérée par des études biochimiques. Les expériences de clonage

fonctionnel effectuées dans le laboratoire n'ont pas permis d'isoler le transporteur de

l'AdoMet chez Leishmania, mais nos études sur les mutants résistants au MTX avaient

suggéré un rôle du métabolisme de l'AdoMet dans la résistance à l'antifolate (83, 127).

D'un autre coté, nous avons observé qu'une souche de L. major sélectionnée pour la

résistance à la sinéfungine (SNF) était environ 2.5 fois plus résistante au MTX (résultats

non publiés). Par la suite nous avons été surpris par le fait que le mutant hautement résistant

au MTX, TarMTXl000.6, montrait une résistance croisée à la SNF. Ces résultats ont mené

à la découverte de l'existence de souches de Leishmania intrinsèquement résistantes à la

SNF et que cette résistance était aussi liée à un défaut dans le transport de l'AdoMet. De

façon intéressante, le mutant TarMTXl 000.6 est non seulement résistant au MTX et à la

SNF, mais est également incapable de transporter l'acide folique et l'AdoMet. En raison

des réarrangements au niveau des gènes de la famille FBT chez TarMTXl000.6 (311),

nous avons émis une hypothèse selon laquelle un membre FBT supprimé ou réarrangé

chez ce mutant pourrait potentiellement transporter l'AdoMet.

Nos travaux ont permis de confirmer que Leishmania possède un transporteur de

haute affinité (Km= 284 nM) pour la 5-adénosylméthionine localisé au niveau de la

membrane plasmique du parasite. Ce transporteur nommé AdoMetTl est également

impliqué dans le transport de la SNF, l'analogue structural de l'AdoMet. AdoMetTl est

codé par un gène FBT (LinJl0.0370 de L. infantum et son orthologue LmjFl0.0360 de L.

major) qui fait partie d'un groupe de 7 gènes FBT en tandem sur le chromosome 10. Ces

résultats suggèrent que ce groupe de gènes FBT en tandem semble avoir évolué suite à des

événements de duplication génique afin de créer de nouvelles fonctions. En effet, le gène

176

codant pour le principal transporteur de folate FT1 et pour l'orthologue du transporteur de

folate de haute affinité FT5 de L. tarentolae sont également situés sur ce locus. D'un autre

côté, cette organisation en tandem semble faciliter le contrôle de l'expression des

transporteurs par des événements de recombinaison génique. En effet, nous avons observé

que le gène AdoMetTl est réarrangé ou délété chez un mutant sélectionné pour la résistance

à la SNF.

Régulation de l'AdoMetTl et de FT 1 en fonction du stade de croissance

Contrairement à l'activité de transport de folate qui est régulée en fonction de la

phase de croissance du parasite, l'activité de transport de l'AdoMet ou de la SNF (186)

n'est pas dépendante de la phase de croissance. Nous avons pu démontrer, grâce à la

génération d'une protéine AdoMetTl fusionnée avec la protéine fluorescente verte (GFP),

que cette chimère était produite durant les différentes phases de croissance et également

qu'elle se localisait au niveau de la membrane plasmique. En corrélation avec ces résultats,

nous avons également observé que l'ARNm d^AdoMetTl était exprimé de façon

constitutive (Figure 3, Chapitre II). D'autre part, nous avons déjà observé que la protéine

FT1 est produite en phase logarithmique de croissance, mais subit une dégradation en phase

stationnaire de croissance (312). Le fait que seule la séquence codante de FT1 a été clonée

dans un vecteur d'expression permettant l'expression constitutive des gènes suggère qu'un

mécanisme post-traductionnel est impliqué dans le contrôle de l'expression de la protéine

FT1 (312). Notre hypothèse est que la voie de dégradation ubiquitine-dépendante soit

impliquée dans cette régulation. En effet, chez les cellules eucaryotes l'ubiquitination joue

un rôle important dans l'internalisation des protéines membranaires suivi par leur

dégradation spécifique dans le lysosome (revue dans (141, 231, 357)). L'ubiquitine est une

petite protéine (76 acides aminés) dont la séquence est hautement conservée chez les

eucaryotes. Elle se fixe de façon covalente aux protéines cibles, ce qui permet leur

acheminement vers le lysosome par endocytose. Nous avons identifié dans le génome de

Leishmania les gènes codant pour l'ubiquitine et les enzymes de la machinerie

d'ubiquitination. Des essais d'immunoprecipitation sur la protéine FT1 fusionnée avec la

GFP suivi de la détection de l'ubiquitine par Western blot pourraient démontrer si

l'ubiquitination est responsable de la régulation post-traductionnelle de FT1. Des

177

expériences de fusion entre l'AdoMetTl et FT1 pourraient contribuer à l'accroissement de

nos connaissances sur le sujet en permettant d'identifier la portion impliquée dans la

degradation de FT1. Malgré la grande homologie de séquence entre l'AdoMetTl et FT1

(80 % de similarité), les deux protéines transportent différents substrats. Cette différence

fonctionnelle peut être attribuée aux domaines contenant des acides aminés divergents entre

les deux protéines. Ainsi, la génération de transporteurs chimères en échangeant des

domaines spécifiques entre les deux transporteurs pourrait également aider à l'identification

de la région impliquée dans la discrimination entre l'AdoMet et l'acide folique.

Rôle de l'AdoMetTl dans la résistance à la sinéfungine (SNF)

La sinéfungine (Fig. 1.9, Chapitre I) est un antibiotique à forte activité

leishmanicide in vitro et in vivo (18, 20, 247, 270). Elle a également montré une forte

activité contre d'autres parasites comme Plasmodium (378), Cryptosporidium parvum (41)

et les trypanosomes (84). Pour toutes ces raisons, il a été suggéré que la SNF pourrait servir

de molécule modèle pour le développement de nouveaux médicaments anti-parasitaires

(249). La littérature a rapporté l'existence de souches intrinsèquement résistantes à la SNF

(16) et nous avons également observé ce phénomène chez deux souches de laboratoire (L.

infantum JPCM5 et L. major Friedlin). Cette résistance était liée à une réduction du Fmax du

système de transport de l'AdoMet (186, 290). Nos résultats permettent d'expliquer cette

résistance par une sous-expression de l'ARNm du transporteur primaire d'AdoMet. Le

mécanisme responsable de cette régulation n'est pas encore connu, mais il pourrait être lié à

un réarrangement au niveau des gènes FBT. Par ailleurs, la suppression du gène AdoMetTl

par des expériences d'inactivation génique a conduit à une forte résistance à la SNF. Chez

la levure S. cerevisiae, la résistance à la SNF est dû à une mutation qui inactive directement

le transporteur d'AdoMet SAM3 (421). Globalement, ces résultats démontrent que la

modulation de l'expression de l'AdoMetTl a un impact profond sur la sensibilité à la SNF.

Pourquoi Leishmania possède un transporteur d'AdoMet ?

Leishmania a la faculté de synthétiser l'AdoMet mais il possède également un

transporteur de haute affinité au niveau de sa membrane plasmique qui lui permet

d'importer activement cette molécule. Par contre, la présence des souches intrinsèquement

178

déficientes dans le système de transport de l'AdoMet, mais qui peuvent se multiplier

normalement dans nos conditions de culture, suggère que le parasite ne nécessite pas la

présence du transporteur AdoMetTl pour subvenir à ses besoins. En effet, la souche de L.

infantum délétée du gène AdoMetTl ne diffère pas de la souche sauvage en termes de

croissance et de capacité à infecter les macrophages et de se multiplier à l'intérieur des

phagolysosomes (résultats non publiés). D'autres types de cellules, comme celles des

mammifères, dépendent principalement de la voie de biosynthèse pour subvenir à leurs

besoins en AdoMet et n'importent que très peu cette molécule du milieu extracellulaire (38,

222). Jusqu'à présent, le seul organisme qui dépend exclusivement d'une source exogène

d'AdoMet pour survivre est Rickettsia prowazekii. Cette bactérie possède une enzyme

MAT non fonctionnelle, mais dispose d'un transporteur (SAM) de haute affinité pour

l'AdoMet qui lui permet de compenser ce défaut et de survivre en absence de l'enzyme

MAT (82, 381). Le parasite se multiplie à l'intérieur de l'intestin de l'insecte vecteur et le

phagolysosome des macrophages (les parasites infectent principalement ces cellules) de

l'hôte vertébré. Les niveaux de nutriments peuvent variés considérablement dans ces deux

niches au cours de l'infection et le parasite doit faire face à ces changements pour survivre.

Par exemple, les parasites peuvent se retrouver dans un environnement riche en nutriments

dans l'intestin de l'insecte vecteur lorsque celui-ci digère son repas sanguin et se nourrit de

la sève des plantes (riche en sucres). À certains moments, ces nutriments peuvent

gravement s'appauvrir et les parasites métacycliques (en phase stationnaire de croissance)

qui se trouvent dans la partie supérieure de l'intestin peuvent être privés de nutriments.

Chez l'hôte mammifère, les parasites peuvent faire face à une limitation des nutriments au

cours de la phagocytose par des neutrophiles (286) puisque les phagolysosmes de ces

cellules immunitaires sont considérés comme pauvres en éléments nutritifs (e.g. acides

aminés) (323). Il serait donc possible que le parasite favorise le système de transport plutôt

que la voie de biosynthèse lorsque les concentrations en molécules précurseurs d'AdoMet

(e.g. methionine, ATP) sont limitées. Par ailleurs, le parasite est auxotrophe pour les

purines (51) et pourrait se servir du transporteur de l'AdoMet comme source de ces

molécules lorsque celles-ci se trouvent en faible concentration. Il a été démontré que

l'expression de l'enzyme MAT2 ainsi que son activité sont élevées en phase logarithmique

de croissance et diminuent fortement en phase stationnaire (282). Le transport d'AdoMet

179

n'est pas dépendant des phases de croissance. Ceci suggère que, lorsque l'activité de

synthèse est réduite et que le substrat est disponible dans le milieu, le parasite peut importer

l'AdoMet. La découverte d'AdoMetTl va nous permettre de tester certaines de ces

hypothèses. Par exemple, il serait intéressant de voir si le transporteur peut complementer

un mutant où le gène MAT est inactivé, car chez d'autres organismes le gène MAT est

essentiel (82, 401).

Chapitre IV. Localisation intracellulaire des protéines de la famille des transporteurs de folate et de la bioptérine (FBT) et de la famille des transporteurs mitochondriaux (MCF) chez Leishmania.

Le séquençage du génome de Leishmania a facilité les études sur les enzymes du

métabolisme monocarboné chez ce parasite. Certaines études ont même fourni des

évidences que ce métabolisme est compartimenté entre le cytoplasme et la mitochondrie

(106, 237, 344, 393). Il a été suggéré que le dérivé de folate 10-folmyl-THF, un metabolite

synthétisé exclusivement dans le cytoplasme chez L. major, pourrait être transporté vers la

mitochondrie pour remplir ses fonctions métaboliques (240, 393). L'AdoMet est un

donneur universel de groupement méthyl et doit être transporté vers les différents

compartiments de la cellule pour des réactions de methylation cellulaire. Puisque le

transport de folate et de l'AdoMet à travers la membrane plasmique du parasite est assuré

par deux membres de la famille des transporteurs de folate et de la bioptérine (FBT), il est

possible que d'autres membres de cette famille soient impliqués dans le transport de ces

molécules du cytosol vers la mitochondrie. Nous avons donc étudié la localisation des 13

protéines de la famille FBT dans le but d'identifier les transporteurs mitochondriaux. Nos

résultats montrent que trois protéines FBT sont localisées dans des compartiments

intracellulaires alors que les dix autres sont localisées au niveau de la membrane plasmique

du parasite. Il est peu probable que les protéines intracellulaires soient localisées au niveau

de la membrane de la mitochondrie si on les compare aux protéines appartenant à la famille

des transporteurs mitochondriaux (MCF). Des expériences de co-localisation avec des

fluorophores spécifiques pour certains compartiments (noyau, reticulum endoplasmique,

appareil de Golgi, mitochondrie) devraient fournir l'information nécessaire afin de

180

déterminer les organites où sont localisées les protéines FBT intracellulaires. Toutefois, il

serait aussi important de confirmer le profil d'expression de ces protéines par des

techniques de Western blot et de fractionnement subcellulaire.

Chez les mammifères le transport de folate et de l'AdoMet à travers la membrane de

la mitochondrie est assuré par des protéines appartenant à la famille des transporteurs

mitochondriaux (MCF) (1, 217, 376). Le génome de Leishmania code pour au moins 32

protéines de la MCF (67). Grâce à une analyse phylogénique et à la recherche de similarité

par BlastP nous avons identifié des protéines qui pourraient potentiellement être impliquées

dans le transport des substrats d'intérêts (e.g. folate, AdoMeT, thiamine, pyrimidine). La

fonction de ces protéines, ainsi que celle des protéines FBT intracellulaires, sera mise en

évidence par des études de transport sur des organites purifiés. On pourrait éventuellement

avoir recours à des expériences d'expression en systèmes hétérologues (e.g. bactéries,

ovocyte de Xenopus) ou de reconstitution en protéoliposomes pour caractériser la fonction

de ces protéines.

Qu'elle est la fonction des transporteurs FBT localisés au niveau de la membrane

plasmique ?

Sur les 10 transporteurs FBT de L. infantum localisés au niveau de la membrane

plasmique du parasite, on distingue le principal transporteur de folate FT1 (LinJ 10.0400), le

principal transporteur de la S-adénosylméthionine AdoMetTl (LinJlO.0370) et les deux

protéines orthologues de FT5 et de BT1 (respectivement, LinJlO.0420 et LinJ35.5120). La

fonction des six autres FBT est jusqu'à présent inconnue, mais nous pourrions tester

quelques hypothèses de travail pour identifier leur substrat. La transfection de chaque gène

de façon indépendante, chez un mutant ne transportant pas l'acide folique ont permit de

voir si ceux-ci transportent l'acide folique. En effet, des expériences de courbe de

croissance en présence du MTX ont permis de constater que ces protéines ne transportent

pas l'acide folique (résultats non montrés). De plus, des études de transport de l'acide

folique et de certains dérivés du tétrahydrofolate (THF) comme le 10-Methyl-THF et le 5-

Formyl-THF ont permis de confirmer que certaines de ces protéines (LinJ06.1320,

LinJl0.0380, LinJ 10.0410, LinJ 19.0780) ne transportent pas ces substrats, contrairement à

FT1 (notre contrôle positif). Toutefois les concentrations de substrat utilisées étaient de

181

l'ordre du nanomolaire (< 400 nM) ce qui n'exclu pas que ces transporteurs pourraient

avoir une faible affinité pour les folates. Nous allons donc vérifier si ces protéines sont des

transporteurs de faible affinité en utilisant des concentrations élevées de folates.

Puisque le folate, la bioptérine et l'AdoMet étaient les seuls substrats identifiés de la

famille FBT, nous avons fait une recherche par structure dans des bases de données (e.g.

DrugBank database, the human metabolome database (HMDB), chemical abstract service

(CAS)) afin de trouver des molécules dont la structure ressemble aux trois substrats

identifiés de la famille FBT. Parmi les molécules obtenues par cette analyse nous avons

porté un intérêt particulier sur des metabolites essentiels tels les vitamines (en particulier de

la classe B; folate, pyridoxine, riboflavine, cobalamine, thiamine) et certains cofacteurs

(e.g. NAD, FAD, AMPc, Acétyl-CoA). En effet, Leishmania est auxotrophe pour plusieurs

metabolites essentiels tels les acides aminés, les purines, les vitamines et l'hème et doit

donc les importer de l'extérieur (218). Des études de transport avec des substrats marqués

au tritium ou des expériences de courbe de croissance avec des analogues structuraux à

activité leishmanicide sont en cours afin de déterminer si la famille FBT est impliquée dans

le transport de ces metabolites, particulièrement les vitamines.

Chez les procaryotes, une nouvelle classe de transporteurs de vitamines a

récemment été décrite (316). En combinant une analyse du contexte génomique avec la

reconstruction de réseaux métaboliques, plusieurs substrats (principalement des vitamines)

ont été prédits pour les différents transporteurs de cette classe. La fonction de certains

d'entre eux a même été validée expérimentalement (e.g. transporteur de folate, thiamine,

riboflavine, biotine) (316). L'organisation de certains gènes FBT en tandem ainsi que la

caractérisation fonctionnelle de FT1 et de l'AdoMetTl suggèrent que ce locus pourrait

coder pour des gènes qui sont impliqués dans le même sentier métabolique, celui du

métabolisme des folates et de l'AdoMet. Il est possible que les autres membres en tandem

soient impliqués dans le transport de cofacteurs utilisés par certaines enzymes de ce sentier

métabolique comme la pyridoxine (cofacteur de la serine hydroxyméthyltransférase, la

cystathionine p-synthase et la y-cystathionase) et le cobalamine (cofacteur de la methionine

synthase).

182

Les antifolates et particulièrement les inhibiteurs de la dihydrofolate reductase

(DHFR) ont été exploités pour traiter plusieurs maladies comme le cancer, les infections

bactériennes et la malaria (173). La DHFR est une cible thérapeutique potentielle chez les

parasites trypanosomatidés (e.g. Leishmania, Trypanosoma) et même si les inhibiteurs de

cette enzyme ont été développés (60, 112, 160, 289), il n'existe malheureusement pas de

traitement à base d'antifolates pour traiter les maladies causées par ces trypanosomatidés.

La raison est que ces parasites possèdent une autre enzyme, PTRl, qui leur permet de

résister aux antifolates (30, 136, 245, 276). En effet, PTRl, dont le rôle principal est la

réduction de la bioptérine, peut également réduire le DHF en THF lorsqu'elle est

surexprimée, conférant ainsi aux parasites un moyen de surpasser l'inhibition de la DHFR

(245). Ces observations suggèrent que la double inhibition de PTRl et de la DHFR serait

une bonne stratégie thérapeutique (136, 246). Récemment, beaucoup d'efforts ont été

déployés pour développer des inhibiteurs ciblant ces enzymes et certains composés ont

généré un enthousiasme important (53, 356, 382). Etant donné le rôle joué par les

transporteurs FBT dans le transport de l'antifolate MTX, il serait intéressant de déterminer

si les nouveaux antifolates désignés pour inhiber spécifiquement la PTRl-DHFR de

Leishmania empruntent les transporteurs FBT pour entrer dans la cellule. Cela permettrait

de prévoir les mécanismes de résistance potentiels à ces molécules impliquant les

transporteurs FBT.

5.2 Conclusions

En conclusion, le parasite protozoaire Leishmania possède une nouvelle classe de

transporteurs de metabolites. Les premiers membres caractérisés de cette classe (FT1, FT5

et BT1) transportent les ptéridines (bioptérine, folate) et forment ainsi la famille des

transporteurs de folate et de la bioptérine (FBT). Le génome de Leishmania code pour

plusieurs homologues de ces protéines de fonction inconnue et notre objectif principal était

de caractériser cette famille et de déterminer la fonction des autres membres. Les travaux

présentés dans cette thèse ont révélé les différences au niveau des profils d'expression des

membres de la famille FBT suggérant ainsi de nouvelles fonctions. Par exemple,

l'expression de plusieurs gènes FBT était élevée chez les parasites en arrêt de

multiplication (phase stationnaire de croissance) ce qui a permis de spéculer que ces

183

transporteurs importent possiblement d'autres molécule que les folates. De plus,

l'expression développementale et adaptative du principal transporteur de folate FT1

démontre l'importance de celui-ci dans la biologie du parasite. Aussi, nous avons expliqué

la corrélation entre la résistance à l'antifolate MTX et le réarrangement des gènes FBT par

des événements de recombinaison génique inactivant le transporteur FT1. Nos études ont

aussi permis de caractériser la fonction d'un autre membre (AdoMetTl) de la famille FBT.

La protéine AdoMetTl a une haute affinité pour l'AdoMet et correspond au transporteur

primaire de cette molécule. En raison de l'importance de l'AdoMet dans les réactions de

methylation, Leishmania importe ce donneur d'unité monocarboné pendant toutes les

phases de croissance. Nous avons aussi montré que cette accumulation non-dépendante de

la phase de croissance était corrélée avec l'expression de l'AdoMetTl. La caractérisation

d'AdoMetTl a également permis d'associer la résistance à la sinéfungine avec les bas

niveaux d'expression de ce transporteur. Enfin, nous avons étudié la localisation de tous les

membres de la famille FBT et identifié d'autres protéines (appartenant à la famille des

transporteurs mitochondriaux (MCF)) comme étant des transporteurs potentiels de folate et

de l'AdoMet chez Leishmania. Finalement, ces études de localisation vont nous permettre

d'évaluer le transport de plusieurs substrats d'intérêt afin de trouver de nouvelles fonctions

aux protéines FBT. La caractérisation fonctionnelle de la famille FBT est nécessaire afin de

comprendre le rôle de chacun de ces membres dans la biologie du parasite et pourrait peut-

être un jour conduire à l'élaboration de nouvelles stratégies thérapeutiques impliquant ces

transporteurs.

184

Bibliographie

1. Agrimi, G., M. A. Di Noia, C. M. Marobbio, G. Fiermonte, F. M. Lasorsa, and F. Palmieri. 2004. Identification ofthe human mitochondrial S-adenosylmethionine transporter: bacterial expression, reconstitution, functional characterization and tissue distribution. Biochem J 379:183-90.

2. Allegra, C. J., R. L. Fine, J. C. Drake, and B. A. Chabner. 1986. The effect of methotrexate on intracellular folate pools in human MCF-7 breast cancer cells. Evidence for direct inhibition of purine synthesis. J Biol Chem 261:6478-85.

3. Alvar, J., P. Aparicio, A. Aseffa, M. Den Boer, C. Canavate, J. P. Dedet, L. Gradoni, R. Ter Horst, R. Lopez-Velez, and J. Moreno. 2008. The relationship between leishmaniasis and AIDS: the second 10 years. Clin Microbiol Rev 21:334-59, table of contents.

4. Alvar, J., S. Yactayo, and C. Bern. 2006. Leishmaniasis and poverty. Trends Parasitol 22:552-7.

5. Anacleto, C , M. C. Abdo, A. V. Ferreira, S. M. Murta, A. J. Romanha, A. P. Fern and es, and E. S. Moreira. 2003. Structural and functional analysis of an amplification containing a PGPA gene in a glucantime-resistant Leishmania (Viannia) guyanensis cell line. Parasitol Res 90:110-8.

6. Andersson, J. O., and S. G. Andersson. 1997. Genomic rearrangements during evolution of the obligate intracellular parasite Rickettsia prowazekii as inferred from an analysis of 52015 bp nucleotide sequence. Microbiology 143 ( Pt 8):2783-95.

7. Andersson, S. G., A. Zomorodipour, J. O. Andersson, T. Sicheritz-Ponten, U. C. Alsmark, R. M. Podowski, A. K. Naslund, A. S. Eriksson, H. H. Winkler, and C. G. Kurland. 1998. The genome sequence of Rickettsia prowazekii and the origin of mitochondria. Nature 396:133-40.

8. Arco, A. D., and J. Satrustegui. 2005. New mitochondrial carriers: an overview. Cell Mol Life Sci. 62:2204-27.

9. Arrebola, R., A. Olmo, P. Reche, E. P. Garvey, D. V. Santi, L. M. Ruiz-Perez, and D. Gonzalez-Pacanowska. 1994. Isolation and characterization of a mutant dihydrofolate reductase-thymidylate synthase from methotrexate-resistant Leishmania cells. J Biol Chem 269:10590-6.

10. Ashokkumar, B., Z. M. Mohammed, N. D. Vaziri, and H. M. Said. 2007. Effect of folate oversupplementation on folate uptake by human intestinal and renal epithelial cells. Am J Clin Nutr 86:159-66.

11. Aslinia, F., J. J. Mazza, and S. H. Yale. 2006. Megaloblastic anemia and other causes of macrocytosis. Clin Med Res 4:236-41.

12. Assaraf, Y. G. 2007. Molecular basis of antifolate resistance. Cancer Metastasis Rev 26:153-81.

13. Assaraf, Y. G. 2006. The role of multidrug resistance efflux transporters in antifolate resistance and folate homeostasis. Drug Resist Updat 9:227-46.

14. Atreya, C. E., E. F. Johnson, J. Williamson, S. Y. Chang, P. H. Liang, and K. S. Anderson. 2003. Probing electrostatic channeling in protozoal bifunctional thymidylate synthase-dihydrofolate reductase using site-directed mutagenesis. J Biol Chem 278:28901-11.

185

15. Austin, M. U., W. S. Liau, K. Balamurugan, B. Ashokkumar, H. M. Said, and C. W. LaMunyon. 2010. Knockout ofthe folate transporter folt-1 causes germline and somatic defects in C. elegans. BMC Dev Biol 10:46.

16. Avila, J. L., and A. Avila. 1987. Correlation of sinefungin susceptibility and drug-affinity for protein carboxymethyltransferase activity in American Leishmania species. Mol Biochem Parasitol 26:69-75.

17. Avila, J. L., and M. A. Polegre. 1993. Uptake and metabolism of S-adenosyl-L-methionine by Leishmania mexicana and Leishmania braziliensis promastigotes. Mol Biochem Parasitol 58:123-34.

18. Avila, J. L., T. Rojas, H. Monzon, and J. Convit. 1990. Sinefungin as treatment for American Leishmania in sensitive BALB/c and resistant C57BL/6 mice. Am J Trop Med Hyg 43:139-45.

19. Bacchi, C. J., B. Goldberg, J. Garofalo-Hannan, D. Rattendi, P. Lyte, and N. Yarlett. 1995. Fate of soluble methionine in African trypanosomes: effects of metabolic inhibitors. Biochem J 309 ( Pt 3):737-43.

20. Bachrach, U., L. F. Schnur, J. El-On, C. L. Greenblatt, E. Pearlman, M. Robert-Gero, and E. Lederer. 1980. Inhibitory activity of sinefungin and SIBA (5'-deoxy-5'-S-isobutylthio-adenosine) on the growth of promastigotes and amastigotes of different species of Leishmania. FEBS Lett 121:287-91.

21. Balamurugan, K., B. Ashokkumar, M. Moussaif, J. Y. Sze, and H. M. Said. 2007. Cloning and functional characterization of a folate transporter from the nematode Caenorhabditis elegans. Am J Physiol Cell Physiol 293:C670-81.

22. Banerjee, R., and C. G. Zou. 2005. Redox regulation and reaction mechanism of human cystathionine-beta-synthase: a PLP-dependent hemesensor protein. Arch Biochem Biophys 433:144-56.

23. Banuls, A. L., M. Hide, and F. Prugnolle. 2007. Leishmania and the leishmaniases: a parasite genetic update and advances in taxonomy, epidemiology and pathogenicity in humans. Adv Parasitol 64:1-109.

24. Basselin, M., H. Denise, G. H. Coombs, and M. P. Barrett. 2002. Resistance to pentamidine in Leishmania mexicana involves exclusion of the drug from the mitochondrion. Antimicrob Agents Chemother 46:3731-8.

25. Basu, N. K., L. Kole, A. Ghosh, and P. K. Das. 1997. Isolation of a nitric oxide synthase from the protozoan parasite, Leishmania donovani. FEMS Microbiol Lett 156:43-7.

26. Bayly, A. M., J. M. Berglez, O. Patel, L. A. Castclli, E. G. Hankins, P. Coloe, C. Hopkins Sibley, and I. G. Macreadie. 2001. Folic acid utilisation related to sulfa drug resistance in Saccharomyces cerevisiae. FEMS Microbiol Lett 204:387-90.

27. Beck, J. T., and B. Ullman. 1991. Biopterin conversion to reduced folates by Leishmania donovani promastigotes. Mol Biochem Parasitol 49:21-8.

28. Beck, J. T., and B. Ullman. 1990. Nutritional requirements of wild-type and folate transport-deficient Leishmania donovani for pterins and folates. Mol Biochem Parasitol 43:221-30.

29. Bedhomme, M., M. Hoffmann, E. A. McCarthy, B. Gambonnet, R. G. Moran, F. Rebeille, and S. Ravanel. 2005. Folate metabolism in plants: an Arabidopsis homolog of the mammalian mitochondrial folate transporter mediates folate import into chloroplasts. J Biol Chem 280:34823-31.

186

30. Bello, A. R., B. Nare, D. Freedman, L. Hardy, and S. M. Beverley. 1994. PTRl : a reductase mediating salvage of oxidized ptéridines and methotrexate resistance in the protozoan parasite Leishmania major. Proc Natl Acad Sci U S A 91:11442-6.

31. Beverley, S. M. 1991. Gene amplification in Leishmania. Annu Rev Microbiol 45:417-44.

32. Beverley, S. M., and C. M. Coburn. 1990. Recurrent de novo appearance of small linear DNAs in Leishmania major and relationship to extra-chromosomal DNAs in other species. Mol Biochem Parasitol 42:133-41.

33. Beverley, S. M., J. A. Coderre, D. V. Santi, and R. T. Schimke. 1984. Unstable DNA amplifications in methotrexate-resistant Leishmania consist of extrachromosomal circles which relocalize during stabilization. Cell 38:431-9.

34. Beverley, S. M., T. E. Ellenberger, and J. S. Cordingley. 1986. Primary structure of the gene encoding the bifunctional dihydrofolate reductase-thymidylate synthase of Leishmania major. Proc Natl Acad Sci U S A 83:2584-8.

35. Bhattacharya, S. K., T. K. Jha, S. Sundar, C. P. Thakur, J. Engel, H. Sindermann, K. Junge, J. Karbwang, A. D. Bryceson, and J. D. Berman. 2004. Efficacy and tolerability of miltefosine for childhood visceral leishmaniasis in India. Clin Infect Dis 38:217-21.

36. Birn, H., O. Spiegelstein, E. I. Christensen, and R. H. Finnell. 2005. Renal tubular reabsorption of folate mediated by folate binding protein 1. J Am Soc Nephrol 16:608-15.

37. Bombardieri, G., G. Pappalardo, L. Bernardi, D. Barra, A. Di Palma, and G. Castrini. 1983. Intestinal absorption of S-adenosyl-L-methionine in humans. Int J Clin Pharmacol Ther Toxicol 21:186-8.

38. Bontemps, F., and G. Van Den Berghe. 1997. Metabolism of exogenous S-adenosylmethionine in isolated rat hepatocyte suspensions: methylation of plasma-membrane phospholipids without intracellular uptake. Biochem J 327 ( Pt 2):383-9.

39. Boucher, N., Y. Wu, C. Dumas, M. Dube, D. Sereno, M. Breton, and B. Papadopoulou. 2002. A common mechanism of stage-regulated gene expression in Leishmania mediated by a conserved 3'-untranslated region element. J Biol Chem 277:19511-20.

40. Bouvier, F., N. Linka, J. C. Isner, J. Mutterer, A. P. Weber, and B. Camara. 2006. Arabidopsis SAMT1 defines a plastid transporter regulating plastid biogenesis and plant development. Plant Cell 18:3088-105.

41. Brasseur, P., D. Lemeteil, and J. J. Ballet. 1993. Curative and preventive anticryptosporidium activities of sinefungin in an immunosuppressed adult rat model. Antimicrob Agents Chemother 37:889-92.

42. Bray, P. G., M. P. Barrett, S. A. Ward, and H. P. de Koning. 2003. Pentamidine uptake and resistance in pathogenic protozoa: past, present and future. Trends Parasitol 19:232-9.

43. Brin gaud, F., M. Muller, G. C. Cerqueira, M. Smith, A. Rochette, N. M. El-Sayed, B. Papadopoulou, and E. Ghedin. 2007. Members of a large retroposon family are determinants of post-transcriptional gene expression in Leishmania. PLoSPathog3:1291-307.

44. Britto, C , C. Ravel, P. Bastien, C. Blaineau, M. Pages, J. P. Dedet, and P. Wincker. 1998. Conserved linkage groups associated with large-scale

187

chromosomal rearrangements between Old World and New World Leishmania genomes. Gene 222:107-17.

45. Brosnan, J. T., R. da Silva, and M. E. Brosnan. 2007. Amino acids and the regulation of methyl balance in humans. Curr Opin Clin Nutr Metab Care 10:52-7.

46. Callahan, H. L., and S. M. Beverley. 1991. Heavy metal resistance: a new role for P-glycoproteins in Leishmania. J Biol Chem 266:18427-30.

47. Callahan, H. L., and S. M. Beverley. 1992. A member ofthe aldoketo reductase family confers methotrexate resistance in Leishmania. J Biol Chem 267:24165-8.

48. Canfield, C. J., W. K. Milhous, A. L. Ager, R. N. Rossan, T. R. Sweeney, N. J. Lewis, and D. P. Jacobus. 1993. PS-15: a potent, orally active antimalarial from a new class of folic acid antagonists. Am J Trop Med Hyg 49:121-6.

49. Cao, W., and L. H. Matherly. 2004. Analysis of the membrane topology for transmembrane domains 7-12 of the human reduced folate carrier by scanning cysteine accessibility methods. Biochem J 378:201-6.

50. Carter, E. L., L. Jager, L. Gardner, C. C. Hall, S. Willis, and J. M. Green. 2007. Escherichia coli abg genes enable uptake and cleavage ofthe folate catabolite p-aminobenzoyl-glutamate. J Bacteriol 189:3329-34.

51. Carter, N. S., P. Yates, C. S. Arendt, J. M. Boitz, and B. Ullman. 2008. Purine and pyrimidine metabolism in Leishmania. Adv Exp Med Biol 625:141-54.

52. Carter, N. S., P. A. Yates, S. K. Gessford, S. R. Galagan, S. M. Landfear, and B. Ullman. 2010. Adaptive responses to purine starvation in Leishmania donovani. Mol Microbiol 78:92-107.

53. Cavazzuti, A., G. Paglietti, W. N. Hunter, F. Gamarro, S. Piras, M. Loriga, S. Allecca, P. Corona, K. McLuskey, L. Tulloch, F. Gibellini, S. Ferrari, and M. P. Costi. 2008. Discovery of potent ptéridine reductase inhibitors to guide antiparasite drug development. Proc Natl Acad Sci U S A 105:1448-53.

54. Cha, S. II., T. Sekine, J. I. Fukushima, Y. Kanai, Y. Kobayashi, T. Goya, and H. Endou. 2001. Identification and characterization of human organic anion transporter 3 expressing predominantly in the kidney. Mol Pharmacol 59:1277-86.

55. Chang, A. B., R. Lin, W. Keith Studley, C. V. Tran, and M. H. Saier, Jr. 2004. Phylogeny as a guide to structure and function of membrane transport proteins. Mol Membr Biol 21:171-81.

56. Charriere, F., T. H. Tan, and A. Schneider. 2005. Mitochondrial initiation factor 2 of Trypanosoma brucei binds imported formylated elongator-type tRNA(Met). J Biol Chem 280:15659-65.

57. Chen, Z. S., K. Lee, S. Walther, R. B. Raftogianis, M. Kuwano, H. Zeng, and G. D. Kruh. 2002. Analysis of methotrexate and folate transport by multidrug resistance protein 4 (ABCC4): MRP4 is a component of the methotrexate efflux system. Cancer Res 62:3144-50.

58. Cheng, X., and R. J. Roberts. 2001. AdoMet-dependent methylation, DNA methyltransferases and base flipping. Nucleic Acids Res 29:3784-95.

59. Cheok, M. H., S. Lugthart, and W. E. Evans. 2006. Pharmacogenomics of acute leukemia. Annu Rev Pharmacol Toxicol 46:317-53.

60. Chowdhury, S. F., R. Di Lucrezia, R. H. Guerrero, R. Brun, J. Goodman, L. M. Ruiz-Perez, D. G. Pacanowska, and I. H. Gilbert. 2001. Novel inhibitors of Leishmanial dihydrofolate reductase. Bioorg Med Chem Lett 11:977-80.

188

61. Chrebet, G. L., D. Wisniewski, A. L. Perkins, Q. Deng, M. B. Kurtz, A. Marcy, and S. A. Parent. 2005. Cell-based assays to detect inhibitors of fungal mRNA capping enzymes and characterization of sinefungin as a cap méthyltransférase inhibitor. J Biomol Screen 10:355-64.

62. Christensen, K E., and R. E. MacKenzie. 2006. Mitochondrial one-carbon metabolism is adapted to the specific needs of yeast, plants and mammals. Bioessays 28:595-605.

63. Clayton, C , and M. Shapira. 2007. Post-transcriptional regulation of gene expression in trypanosomes and leishmanias. Mol Biochem Parasitol 156:93-101.

64. Clayton, C. E. 2002. Life wimout transcriptional control? From fly to man and back again. EMBO J 21:1881-8.

65. Coderre, J. A., S. M. Beverley, R. T. Schimke, and D. V. Santi. 1983. Overproduction of a bifunctional thymidylate synthetase-dihydrofolate reductase and DNA amplification in methotrexate-resistant Leishmania tropica. Proc Natl Acad SciU S A 80:2132-6.

66. Coelho, A. C , S. M. Beverley, and P. C. Cotrim. 2003. Functional genetic identification of PRP1, an ABC transporter superfamily member conferring pentamidine resistance in Leishmania major. Mol Biochem Parasitol 130:83-90.

67. Colasante, C , P. Pena Diaz, C. Clayton, and F. Voncken. 2009. Mitochondrial carrier family inventory of Trypanosoma brucei brucei: Identification, expression and subcellular localisation. Mol Biochem Parasitol 167:104-17.

68. Croft, S. L., K. Seifert, and V. Yardley. 2006. Current scenario of drug development for leishmaniasis. Indian J Med Res 123:399-410.

69. Croft, S. L., S. Sundar, and A. H. Fairlamb. 2006. Drug resistance in leishmaniasis. Clin Microbiol Rev 19:111-26.

70. Cruz, A., and S. M. Beverley. 1990. Gene replacement in parasitic protozoa. Nature 348:171-3.

71. Cruz, A., C. M. Coburn, and S. M. Beverley. 1991. Double targeted gene replacement for creating null mutants. Proc Natl Acad Sci U S A 88:7170-4.

72. Cruz, A. K., R. Titus, and S. M. Beverley. 1993. Plasticity in chromosome number and testing of essential genes in Leishmania by targeting. Proc Natl Acad SciU S A90:1599-603.

73. Cunningham, M. L., and S. M. Beverley. 2001. Ptéridine salvage throughout the Leishmania infectious cycle: implications for antifolate chemotherapy. Mol Biochem Parasitol 113:199-213.

74. Cunningham, M. L., R. G. Titus, S. J. Turco, and S. M. Beverley. 2001. Regulation of differentiation to the infective stage of the protozoan parasite Leishmania major by tetrahydrobiopterin. Science 292:285-7.

75. Cybulski, R. L., and R. R. Fisher. 1981. Uptake of oxidized folates by rat liver mitochondria. Biochim Biophys Acta 646:329-33.

76. Dawson, A., F. Gibellini, N. Sienkiewicz, L. B. Tulloch, P. K. Fyfe, K. McLuskey, A. H. Fairlamb, and W. N. Hunter. 2006. Structure and reactivity of Trypanosoma brucei ptéridine reductase: inhibition by the archetypal antifolate methotrexate. Mol Microbiol 61:1457-68.

77. de Crecy-Lagard, V., B. El Yacoubi, R. D. de la Garza, A. Noiriel, and A. D. Hanson. 2007. Comparative genomics of bacterial and plant folate synthesis and salvage: predictions and validations. BMC Genomics 8:245.

189

78. Deng, Y., Z. Hou, L. Wang, C. Cherian, J. Wu, A. Gangjee, and L. H. Matherly. 2008. Role of lysine 411 in substrate carboxyl group binding to the human reduced folate carrier, as determined by site-directed mutagenesis and affinity inhibition. Mol Pharmacol 73:1274-81.

79. Desjeux, P. 2004. Leishmaniasis. Nat Rev Microbiol 2:692. 80. Dixon, K H., B. C. Lanpher, J. Chiu, K Kelley, and K H. Cowan. 1994. A

novel cDNA restores reduced folate carrier activity and methotrexate sensitivity to transport deficient cells. J Biol Chem 269:17-20.

81. Dridi, L., A. Haimeur, and M. Ouellette. 2010. Structure-function analysis of me highly conserved charged residues ofthe membrane protein FT1, the main folic acid transporter ofthe protozoan parasite Leishmania. Biochem Pharmacol 79:30-8.

82. DriskeU, L. O., A. M. Tucker, H. H. Winkler, and D. O. Wood. 2005. Rickettsial metK-encoded methionine adénosyltransférase expression in an Escherichia coli metK deletion strain. J Bacteriol 187:5719-22.

83. Drummelsmith, J., I. Girard, N. Trudel, and M. Ouellette. 2004. Differential protein expression analysis of Leishmania major reveals novel roles for methionine adénosyltransférase and S-adenosylmethionine in methotrexate resistance. J Biol Chem 279:33273-80.

84. Dube, D. K., G. Mpimbaza, A. C. Allison, E. Lederer, and L. Rovis. 1983. Antitrypanosomal activity of sinefungin. Am J Trop Med Hyg 32:31-3.

85. Duthie, S. J., S. Narayanan, G. M. Brand, L. Pirie, and G. Grant. 2002. Impact of folate deficiency on DNA stability. J Nutr 132:2444S-2449S.

86. Dutta, B., W. Huang, M. Molero, R. Kekuda, F. H. Leibach, L. D. Devoe, V. Ganapathy, and P. D. Prasad. 1999. Cloning ofthe human thiamine transporter, a member ofthe folate transporter family. J Biol Chem 274:31925-9.

87. Dyall, S. D., C. M. Koehler, M. G. Delgadillo-Correa, P. J. Bradley, E. Plumper, D. Leuenberger, C. W. Turck, and P. J. Johnson. 2000. Presence of a member of the mitochondrial carrier family in hydrogenosomes: conservation of membrane-targeting pathways between hydrogenosomes and mitochondria. Mol Cell Biol 20:2488-97.

88. Eitinger, T., D. A. Rodionov, M. Grote, and E. Schneider. 2010. Canonical and ECF-type ATP-binding cassette importers in prokaryotes: diversity in modular organization and cellular functions. FEMS Microbiol Rev 35:3-67.

89. El-Fadili, A., D. Richard, C. Kundig, and M. Ouellette. 2003. Effect of polyglutamylation of methotrexate on its accumulation and the development of resistance in the protozoan parasite Leishmania. Biochem Pharmacol 66:999-1008.

90. El-Sayed, N. M., P. J. Myler, G. Blandin, M. Berriman, J. Crabtree, G. Aggarwal, E. Caler, H. Renauld, E. A. Worthey, C. Hertz-Fowler, E. Ghedin, C. Peacock, D. C. Bartholomeu, B. J. Haas, A. N. Tran, J. R. Wortman, U. C. Alsmark, S. Angiuoli, A. Anupama, J. Badger, F. Bringaud, E. Cadag, J. M. Carlton, G. C. Cerqueira, T. Creasy, A. L. Delcher, A. Djikeng, T. M. Embley, C. Hauser, A. C. Ivens, S. K Kummerfeld, J. B. Pereira-Leal, D. Nilsson, J. Peterson, S. L. Salzberg, J. Shallom, J. C. Silva, J. Sundaram, S. Westenberger, O. White, S. E. Melville, J. E. Donelson, B. Andersson, K. D. Stuart, and N. Hall. 2005. Comparative genomics of trypanosomatid parasitic protozoa. Science 309:404-9.

190

91. El Fadili, A., C. Kundig, and M. Ouellette. 2002. Characterization of the folylpolyglutamate synthetase gene and polyglutamylation of folates in the protozoan parasite Leishmania. Mol Biochem Parasitol 124:63-71.

92. El Fadili. A., C. Kundig, G. Roy, and M. Ouellette. 2004. Inactivation of the Leishmania tarentolae pterin transporter (BTI) and reductase (PTRl) genes leads to viable parasites with changes in folate metabolism and hypersensitivity to the antifolate methotrexate. J Biol Chem 279:18575-82.

93. Ellenberger, T. E., and S. M. Beverley. 1987b. Biochemistry and regulation of folate and methotrexate transport in Leishmania major. J Biol Chem 262:10053-8.

94. Ellenberger, T. E., and S. M. Beverley. 1989. Multiple drug resistance and conservative amplification of the H region in Leishmania major. J Biol Chem 264:15094-103.

95. Ellenberger, T. E., and S. M. Beverley. 1987a. Reductions in methotrexate and folate influx in methotrexate-resistant lines of Leishmania major are independent of R or H region amplification. J Biol Chem 262:13501-6.

96. Ellenberger, T. E., J. E. Wright, A. Rosowsky, and S. M. Beverley. 1989. Wild-type and drug-resistant Leishmania major hydrolyze methotrexate to N-10-methyl-4-deoxy-4-aminopteroate without accumulation of methotrexate polyglutamates. J Biol Chem 264:15960-6.

97. Elwood, P. C. 1989. Molecular cloning and characterization ofthe human folate-binding protein cDNA from placenta and malignant tissue culture (KB) cells. J Biol Chem 264:14893-901.

98. Esteller, M. 2007. Cancer epigenomics: DNA methylomes and histone-modification maps. Nat Rev Genet 8:286-98.

99. Eudes, A., G. B. Erkens, D. J. Slotboom, D. A. Rodionov, V. Naponelli, and A. D. Hanson. 2008. Identification of genes encoding the folate- and thiamine-binding membrane proteins in Firmicutes. J Bacteriol 190:7591-4.

100. Eudes, A., E. R. Kunji, A. Noiriel, S. M. Klaus, T. J. Vickers, S. M. Beverley, J. F. Gregory, 3rd, and A. D. Hanson. 2010. Identification of transport-critical residues in a folate transporter from the folate-biopterin transporter (FBT) family. J Biol Chem 285:2867-75.

101. Feagan, B. G., J. Rochon, R. N. Fedorak, E. J. Irvine, G. Wild, L. Sutherland, A. H. Steinhart, G. R. Greenberg, R. Gillies, M. Hopkins, and et al. 1995. Methotrexate for the treatment of Crohn's disease. The North American Crohn's Study Group Investigators. N Engl J Med 332:292-7.

102. Ferguson, P. L., and W. F. Flintoff. 1999. Topological and functional analysis of the human reduced folate carrier by hemagglutinin epitope insertion. J Biol Chem 274:16269-78.

103. Fontecave, M., M. Atta, and E. Mulliez. 2004. S-adenosylmethionine: nothing goes to waste. Trends Biochem Sci 29:243-9.

104. Fox, J. T., and P. J. Stover. 2008. Folate-mediated one-carbon metabolism. Vitam Horm 79:1-44.

105. Fromm, M. F., H. M. Kauffmann, P. Fritz, O. Burk, H. K Kroemer, R. W. Warzok, M. Eichelbaum, W. Siegmund, and D. Schrenk. 2000. The effect of rifampin treatment on intestinal expression of human MRP transporters. Am J Pathol 157:1575-80.

191

106. Gagnon, D., A. Foucher, I. Girard, and M. Ouellette. 2006. Stage specific gene expression and cellular localization of two isoforms of the serine hydroxymethyltransferase in the protozoan parasite Leishmania. Mol Biochem Parasitol. 150:63-71.

107. Ganapathy, V., S. B. Smith, and P. D. Prasad. 2004. SLC19: the folate/thiamine transporter family. Pflugers Arch 447:641-6.

108. Garvey, E. P., and D. V. Santi. 1986. Stable amplified DNA in drug-resistant Leishmania exists as extrachromosomal circles. Science 233:535-40.

109. Geisel, J. 2003. Folic acid and neural tube defects in pregnancy: a review. J Perinat Neonatal Nurs 17:268-79.

110. Genestra, M., W. J. de Souza, L. Cysne-Finkelstein, and L. L. Leon. 2003. Comparative analysis of the nitric oxide production by Leishmania sp. Med Microbiol Immunol 192:217-23.

111. Giladi, M., N. Altman-Price, I. Levin, L. Levy, and M. Mevarech. 2003. FolM, a new chromosomally encoded dihydrofolate reductase in Escherichia coli. J Bacteriol 185:7015-8.

112. Gilbert, I. H. 2002. Inhibitors of dihydrofolate reductase in Leishmania and trypanosomes. Biochim Biophys Acta 1587:249-57.

113. Goad, L. J., G. G. Hoi/, Jr., and D. H. Beach. 1984. Sterols of Leishmania species. Implications for biosynthesis. Mol Biochem Parasitol 10:161-70.

114. Goldberg, B., D. Rattendi, D. Lloyd, J. R. Sufrin, and C. J. Bacchi. 1998. Effects of intermediates of methionine metabolism and nucleoside analogs on S-adenosylmethionine transport by Trypanosoma brucei brucei and a drug-resistant Trypanosoma brucei rhodesiense. Biochem Pharmacol 56:95-103.

115. Goldberg, B., D. Rattendi, D. Lloyd, N. Yarlett, and C. J. Bacchi. 2000. Kinetics of methionine transport and metabolism by Trypanosoma brucei brucei and Trypanosoma brucei rhodesiense. Arch Biochem Biophys 377:49-57.

116. Goldberg, B., D. Rattendi, D. Lloyd, N. Yarlett, and C. J. Bacchi. 1999. Kinetics of S-adenosylmethionine cellular transport and protein methylation in Trypanosoma brucei brucei and Trypanosoma brucei rhodesiense. Arch Biochem Biophys 364:13-8.

117. Goldberg, B., N. Yarlett, J. Sufrin, D. Lloyd, and C. J. Bacchi. 1997. A unique transporter of S-adenosylmethionine in African trypanosomes. FASEB J 11:256-60.

118. Goldman, I. D. 1971. The characteristics of the membrane transport of amethopterin and the naturally occurring folates. Ann N Y Acad Sci 186:400-22.

119. Goldman, I. D., N. S. Liechtenstein, and V. T. Oliverio. 1968. Carrier-mediated transport ofthe folic acid analogue, methotrexate, in the L1210 leukemia cell. J Biol Chem 243:5007-17.

120. Gourbal, B., N. Sonuc, H. Bhattacharjee, D. Legare, S. Sundar, M. Ouellette, B. P. Rosen, and R. Mukhopadhyay. 2004. Drug uptake and modulation of drug resistance in Leishmania by an aquaglyceroporin. J Biol Chem 279:31010-7.

121. Gregson, A., and C. V. Plowe. 2005. Mechanisms of resistance of malaria parasites to antifolates. Pharmacol Rev 57:117-45.

122. Grillo, M. A., and S. Colombatto. 2005. S-adenosylmethionine and protein methylation. Amino Acids 28:357-62.

123. Grondin, K , A. Haimeur, R. Mukhopadhyay, B. P. Rosen, and M. Ouellette. 1997. Co-amplification ofthe gamma-glutamylcysteine synthetase gene gshl and of

192

the ABC transporter gene pgpA in arsenite-resistant Leishmania tarentolae. EMBO J 16:3057-65.

124. Grondin, K , C. Kundig, G. Roy, and M. Ouellette. 1998. Linear amplicons as precursors of amplified circles in methotrexate-resistant Leishmania tarentolae. Nucleic Acids Res 26:3372-8.

125. Grondin, K , G. Roy, and M. Ouellette. 1996. Formation of extrachromosomal circular amplicons with direct or inverted duplications in drug-resistant Leishmania tarentolae. Mol Cell Biol 16:3587-95.

126. Grumont, R., W. L. Wash tien. D. Caput, and D. V. Santi. 1986. Bifunctional thymidylate synthase-dihydrofolate reductase from Leishmania tropica: sequence homology with the corresponding monofunctional proteins. Proc Natl Acad Sci U S A 83:5387-91.

127. Guimond, C , N. Trudel, C. Brochu, N. Marquis, A. El Fadili, R. Peytavi, G. Briand, D. Richard, N. Messier, B. Papadopoulou, J. Corbeil, M. G. Bergeron, D. Legare, and M. Ouellette. 2003. Modulation of gene expression in Leishmania drug resistant mutants as determined by targeted DNA microarrays. Nucleic Acids Res 31:5886-96.

128. Guldener, I . , G. J. Koehler, C. Haussmann, A. Bâcher, J. Kricke, D. Bêcher, and J. H. Hegemann. 2004. Characterization ofthe Saccharomyces cerevisiae Foil protein: starvation for CI carrier induces pseudohyphal growth. Mol Biol Cell 15:3811-28.

129. Hadwiger, J. A., S. Lee, and R. A. Firtel. 1994. The G alpha subunit G alpha 4 couples to pterin receptors and identifies a signaling pathway that is essential for multicellular development in Dictyostelium. Proc Natl Acad Sci U S A 91:10566-70.

130. Hagenbuch, B., and P. J. Meier. 2004. Organic anion transporting polypeptides of the OATP/ SLC21 family: phylogenetic classification as OATP/ SLCO superfamily, new nomenclature and molecular/functional properties. Pflugers Arch 447:653-65.

131. Haimeur, A., C. Brochu, P. Genest, B. Papadopoulou, and M. Ouellette. 2000. Amplification of the ABC transporter gene PGPA and increased trypanothione levels in potassium antimonyl tartrate (SblII) resistant Leishmania tarentolae. Mol Biochem Parasitol 108:131-5.

132. Hall, M. P., and C. K. Ho. 2006. Characterization of a Trypanosoma brucei RNA cap (guanine N-7) méthyltransférase. RNA 12:488-97.

133. Handman, E. 2001. Leishmaniasis: current status of vaccine development. Clin Microbiol Rev 14:229-43.

134. Hanson, A. D., and J. F. Gregory, 3rd. 2002. Synthesis and turnover of folates in plants. Curr Opin Plant Biol 5:244-9.

135. Hanson, A. D., and S. Roje. 2001. One-Carbon Metabolism in Higher Plants. Annu Rev Plant Physiol Plant Mol Biol 52:119-137.

136. Hardy, L. W., W. Matthews, B. Nare, and S. M. Beverley. 1997. Biochemical and Genetic Tests for Inhibitors of Leishmania Ptéridine Pathways. Exp Parasitol 87:158-70.

137. Henderson, G. B., and E. M. Zevely. 1983. Structural requirements for anion substrates of the methotrexate transport system in L1210 cells. Arch Biochem Biophys 221:438-46.

193

138. Henderson, G. B., E. M. Zevely, and F. M. Huennekens. 1979. Mechanism of folate transport in Lactobacillus casei: evidence for a component shared with the thiamine and biotin transport systems. J Bacteriol 137:1308-14.

139. Henderson, G. B., E. M. Zevely, and F. M. Huennekens. 1977. Purification and properties of a membrane-associated, folate-binding protein from Lactobacillus casei. J Biol Chem 252:3760-5.

140. Herwaldt, B. L. 1999. Leishmaniasis. Lancet 354:1191 -9. 141. Hicke, L., and R. Dunn. 2003. Regulation of membrane protein transport by

ubiquitin and ubiquitin-binding proteins. Annu Rev Cell Dev Biol 19:141-72. 142. Hightower, R. C , L. M. Ruiz-Perez, M. L. Wong, and D. V. Santi. 1988.

Extrachromosomal elements in the lower eukaryote Leishmania. J Biol Chem 263:16970-6.

143. Holm, J., S. I. Hansen, M. Hoier-Madsen, and L. Bostad. 1991. High-affinity folate binding in human choroid plexus. Characterization of radioligand binding, immunoreactivity, molecular heterogeneity and hydrophobic domain of the binding protein. Biochem J 280 ( Pt 1):267-71.

144. Hori, T., D. Ayusawa, K Shimizu, H. Koyama, and T. Seno. 1984. Chromosome breakage induced by thymidylate stress in thymidylate synthase-negative mutants of mouse FM3A cells. Cancer Res 44:703-9.

145. Home, D. W., and R. S. Holloway. 1997. Compartmentation of folate metabolism in rat pancreas: nitrous oxide inactivation of methionine synthase leads to accumulation of 5-methyltetrahydrofolate in cytosol. J Nutr 127:1772-5.

146. Home, D. W., R. S. Holloway, and H. M. Said. 1992. Uptake of 5-formyltetrahydrofolate in isolated rat liver mitochondria is carrier-mediated. J Nutr 122:2204-9.

147. Hou, Z., S. E. Stapels, C. L. Haska, and L. H. Matherly. 2005. Localization of a substrate binding domain of the human reduced folate carrier to transmembrane domain 11 by radioaffinity labeling and cysteine-substituted accessibility methods. J Biol Chem 280:36206-13.

148. Hou, Z., J. Ye, C. L. Haska, and L. H. Matherly. 2006. Transmembrane domains 4, 5, 7, 8, and 10 ofthe human reduced folate carrier are important structural or functional components of the transmembrane channel for folate substrates. J Biol Chem 281:33588-96.

149. Hunter, W. N., M. S. Alphey, C. S. Bond, and A. W. Schuttelkopf. 2003. Targeting metabolic pathways in microbial pathogens: oxidative stress and anti­folate drug resistance in trypanosomatids. Biochem Soc Trans 31:607-10.

150. Hussein, M. J., J. M. Green, and B. P. Nichols. 1998. Characterization of mutations that allow p-aminobenzoyl-glutamate utilization by Escherichia coli. J Bacteriol 180:6260-8.

151. Ibar, C , and A. Orellana. 2007. The import of S-adenosylmethionine into the Golgi apparatus is required for the methylation of homogalacturonan. Plant Physiol 145:504-12.

152. Inoue, K , Y. Nakai, S. Ueda, S. Kamigaso, K. Y. Ohta, M. Hatakeyama, Y. Hayashi, M. Otagiri, and H. Yuasa. 2008. Functional characterization of PCFT/HCP1 as the molecular entity of the carrier-mediated intestinal folate transport system in the rat model. Am J Physiol Gastrointest Liver Physiol 294:G660-8.

194

153. Ivens, A. C , C. S. Peacock, E. A. Worthey, L. Murphy, G. Aggarwal, M. Berriman, E. Sisk, M. A. Rajandream, E. Adlem, R. Aert. A. Anupama, Z. Apostolou, P. Attipoe, N. Bason, C. Bauser, A. Beck, S. M. Beverley, G. Bianchettin, K Borzym, G. Bothe, C. V. Bruschi, M. Collins, E. Cadag, L. Ciarloni, C. Clayton, R. M. Coulson, A. Cronin, A. K Cruz, R. M. Davies, J. De Gaudenzi, D. E. Dobson, A. Duesterhoeft, G. Fazelina, N. Fosker, A. C. Frasch, A. Fraser, M. Fuchs, C. Gabel, A. Goble, A. Goffeau, D. Harris, C. Hertz-Fowler, H. Hilbert, D. Horn, Y. Huang, S. Klages, A. Knights, M. Kube, N. Larke, L. Litvin, A. Lord, T. Louie, M. Marra, D. Masuy, K Matthews, S. Michaeli, J. C. Mottram, S. Muller-Auer, H. Munden, S. Nelson, H. Norbertczak, K Oliver, S. O'Neil, M. Pentony, T. M. Pohl, C. Price, B. Puraelle, M. A. Quail, E. Rabbinowitsch, R. Reinhardt, M. Rieger, J. Rinta, J. Robben, L. Robertson, J. C. Ruiz, S. Rutter, D. Saunders, M. Schafer, J. Schein, D. C. Schwartz, K Seeger, A. Seyler, S. Sharp, H. Shin, D. Sivam, R. Squares, S. Squares, V. Tosato, C. Vogt, G. Volckaert, R. Wambutt, T. Warren, H. Wedler, J. Woodward, S. Zhou, W. Zimmermann, D. F. Smith, J. M. Blackwell, K D. Stuart, B. Bar roll, et al. 2005. The genome of the kinetoplastid parasite, Leishmania major. Science 309:436-42.

154. Jansen, G. 1999. Receptor and carrier-mediated transport systems for folates and antifolates: Exploitation for folatebased chemotherapy and immunotherapy. In Jackman, A.L. (ed.), Antifolate drugs in cancer therapy. Humana Press, Totowa, NJ, pp. 293-321.

155. Joet, T., U. Eckstein-Ludwig, C. Morin, and S. Krishna. 2003. Validation ofthe hexose transporter of Plasmodium falciparum as a novel drug target. Proc Natl Acad Sci U S A 100:7476-9.

156. Kamen, B. A., and A. K. Smith. 2004. A review of folate receptor alpha cycling and 5-methyltetrahydrofolate accumulation with an emphasis on cell models in vitro. Adv Drug Deliv Rev 56:1085-97.

157. Kamen, B. A., M. T. Wang, A. J. Streckfuss, X. Peryea, and R. G. Anderson. 1988. Delivery of folates to the cytoplasm of MA104 cells is mediated by a surface membrane receptor that recycles. J Biol Chem 263:13602-9.

158. Kaufman, S. 1963. The Structure ofthe Phenylalanine-Hydroxylation Cofactor. Proc Natl Acad Sci U S A 50:1085-93.

159. Kaur, K., T. Coons, K. Emmett, and B. Ullman. 1988. Methotrexate-resistant Leishmania donovani genetically deficient in the folate-methotrexate transporter. J Biol Chem 263:7020-8.

160. Khabnadideh, S., D. Pez, A. Musso, R. Brun, L. M. Perez, D. Gonzalez-Pacanowska, and I. H. Gilbert. 2005. Design, synthesis and evaluation of 2,4-diaminoquinazolines as inhibitors of trypanosomal and leishmanial dihydrofolate reductase. Bioorg Med Chem 13:2637-49.

161. Khamesipour, A., S. Rat at i, N. Davoudi, F. Maboudi, and F. Modabber. 2006. Leishmaniasis vaccine candidates for development: a global overview. Indian J Med Res 123:423-38.

162. Kidder, G. W., and B. N. Dutta. 1958. The growth and nutrition of Crithidia fasciculata. J Gen Microbiol 18:621-38.

163. Killick-Kendrick, R. 1999. The biology and control of phlebotomine sand flies. Clin Dermatol 17:279-89.

195

164. Killick-Kendrick, R. 1990. Phlebotomine vectors ofthe leishmaniases: a review. Med Vet Entomol 4:1-24.

165. Kim, Y. I. 1999. Folate and carcinogenesis: evidence, mechanisms, and implications. J Nutr Biochem 10:66-88.

166. Kim, Y. I. 2005. Nutritional epigenetics: impact of folate deficiency on DNA methylation and colon cancer susceptibility. J Nutr 135:2703-9.

167. Kinder, A. J., A. B. Hassell, J. Brand, A. Brownfield, M. Grove, and M. F. Shadforth. 2005. The treatment of inflammatory arthritis with methotrexate in clinical practice: treatment duration and incidence of adverse drug reactions. Rheumatology (Oxford) 44:61-6.

168. Kirsanova, O. V., N. A. Cherepanova, and E. S. Gromova. 2009. Inhibition of C5-cytosine-DNA-methyltransferases. Biochemistry (Mosc) 74:1175-86.

169. Klaus, S. M., E. R. Kunji, G. G. Bozzo, A. Noiriel, R. D. de la Garza, G. J. Basset, S. Ravanel, F. Rébeillé, J. F. r. Gregory, and A. D. Hanson. 2005. Higher plant plastids and cyanobacteria have folate carriers related to those of trypanosomatids. J Biol Chem 280:38457-63.

170. Knighton, D. R., C. C. Kan, E. Howland, C. A. Janson, Z. Hostomska, K M. Welsh, and D. A. Matthews. 1994. Structure of and kinetic channelling in bifunctional dihydrofolate reductase-thymidylate synthase. Nat Struct Biol 1:186-94.

171. Koepsell, H., and H. Endou. 2004. The SLC22 drug transporter family. Pflugers Arch 447:666-76.

172. Kojima, S., S. Ona, I. Iizuka, T. Arai, H. Mori, and K. Kubota. 1995. Antioxidative activity of 5,6,7,8-tetrahydrobiopterin and its inhibitory effect on paraquat-induced cell toxicity in cultured rat hépatocytes. Free Radie Res 23:419-30.

173. Kompis, I. M., K. Islam, and R. L. Then. 2005. DNA and RNA synthesis: antifolates. Chem Rev 105:593-620.

174. Konig, J., D. Rost, Y. Cui, and D. Keppler. 1999. Characterization ofthe human multidrug resistance protein isoform MRP3 localized to the basolateral hepatocyte membrane. Hepatology 29:1156-63.

175. Kovacs, J. A., C. J. Allegra, J. Beaver, D. Boarman, M. Lewis, J. E. Parrillo, B. Chabner, and H. Masur. 1989. Characterization of de novo folate synthesis in Pneumocystis carinii and Toxoplasma gondii: potential for screening therapeutic agents. J Infect Dis 160:312-20.

176. Krajinovic, M., and A. Moghrabi. 2004. Pharmacogenetics of methotrexate. Pharmacogenomics 5:819-34.

177. Kruh, G. D., and M. G. Belinsky. 2003. The MRP family of drug efflux pumps. Oncogene 22:7537-52.

178. Kumar, H. P., J. M. Tsuji, and G. B. Henderson. 1987. Folate transport in Lactobacillus salivarius. Characterization of the transport mechanism and purification and properties ofthe binding component. J Biol Chem 262:7171-9.

179. Kundig, C , A. Haimeur, D. Legare, B. Papadopoulou, and M. Ouellette. 1999a. Increased transport of ptéridines compensates for mutations in the high affinity folate transporter and contributes to methotrexate resistance in the protozoan parasite Leishmania tarentolae. EMBO J 18:2342-51.

196

180. Kundig, C , E. Leblanc, B. Papadopoulou, and M. Ouellette. 1999b. Role ofthe locus and of the resistance gene on gene amplification frequency in methotrexate resistant Leishmania tarentolae. Nucleic Acids Res 27:3653-9.

181. Kutty, G., B. Heraandez-Novoa, M. Czapiga, and J. A. Kovacs. 2008. Pneumocystis encodes a functional S-adenosylmethionine synthetase gene. Eukaryot Cell 7:258-67.

182. Lahav, T., D. Sivam, H. Volpin, M. Ronen, P. Tsigankov, A. Green, N. Holland, M. Kuzyk, C. Borchers, D. Zilberstein, and P. J. Myler. 2011. Multiple levels of gene regulation mediate differentiation of the intracellular pathogen Leishmania. Faseb J 25:515-25.

183. Lainson, R., and J. J. Shaw. 1987. Evolution, classification and geographical distribution. The leishmaniasis in biology andmedicine, W.a.K.-K. Peters, R., Editor. Académie Press, Inc.: New York: 1-20.

184. Landfear, S. M. 2010. Transporters for drug delivery and as drug targets in parasitic protozoa. Clin Pharmacol Ther 87:122-5.

185. Law, C. J., P. C. Maloney, and D. N. Wang. 2008. Ins and outs of major facilitator superfamily antiporters. Annu Rev Microbiol 62:289-305.

186. Lawrence, F., T. Derbecourt, and M. Robert-Gero. 1998. Proton-ATPase activities involved in the uptake of an S-adenosylmethionine analogue. Mol Biochem Parasitol 92:99-109.

187. Lawrence, F., and M. Robert-Gero. 1993. Distribution of macromolecular methylations in promastigotes of Leishmania donovani and impact of sinefungin. J Eukaryot Microbiol 40:581-9.

188. Lemley, C , S. Yan, V. S. Dole, R. Madhubala, M. L. Cunningham, S. M. Beverley, P. J. Myler, and K D. Stuart. 1999. The Leishmania donovani LD1 locus gene ORFG encodes a biopterin transporter (BTI). Mol Biochem Parasitol 104:93-105.

189. Leprohon, P., D. Legare, F. Raymond, E. Madore, G. Hardiman, J. Corbeil, and M. Ouellette. 2009. Gene expression modulation is associated with gene amplification, supernumerary chromosomes and chromosome loss in antimony-resistant Leishmania infantum. Nucleic Acids Res 37:1387-99.

190. Leroch, M., H. E. Neuhaus, S. Kirchberger, S. Zimmermann, M. Melzer, J. Gerhold, and J. Tjaden. 2008. Identification of a novel adenine nucleotide transporter in the endoplasmic reticulum of Arabidopsis. Plant Cell 20:438-51.

191. Liang, P. H., and K S. Anderson. 1998. Substrate channeling and domain-domain interactions in bifunctional thymidylate synthase-dihydrofolate reductase. Biochemistry 37:12195-205.

192. Liu, X. Y., and L. H. Matherly. 2002. Analysis of membrane topology of the human reduced folate carrier protein by hemagglutinin epitope insertion and scanning glycosylation insertion mutagenesis. Biochim Biophys Acta 1564:333-42.

193. Liu, X. Y., T. L. Witt, and L. H. Matherly. 2003. Restoration of high-level transport activity by human reduced folate carrier/ThTrl thiamine transporter chimaeras: role of the transmembrane domain 6/7 linker region in reduced folate carrier function. Biochem J 369:31-7.

194. Longo, N. 2009. Disorders of biopterin metabolism. J Inherit Metab Dis 32:333-42. 195. Looareesuwan, S., J. D. Chulay, C. J. Canfield, and D. B. Hutchinson. 1999.

Malarone (atovaquone and proguanil hydrochloride): a review of its clinical

197

development for treatment of malaria. Malarone Clinical Trials Study Group. Am J Trop Med Hyg 60:533-41.

196. Lu, S. C. 1998. Regulation of hepatic glutathione synthesis. Semin Liver Dis 18:331-43.

197. Lu, S. C. 2000. S-Adenosylmethionine. Int J Biochem Cell Biol 32:391-5. 198. Lu, Y., and P. S. Low. 2002. Folate-mediated delivery of macromolecular

anticancer therapeutic agents. Adv Drug Deliv Rev 54:675-93. 199. Luba, J., B. Nare, P. H. Liang, K S. Anderson, S. M. Beverley, and L. W.

Hardy. 1998. Leishmania major ptéridine reductase 1 belongs to the short chain dehydrogenase family: stereochemical and kinetic evidence. Biochemistry 37:4093-104.

200. Lucock, M. 2004. Is folic acid the ultimate functional food component for disease prevention? BMJ 328:211-4.

201. Lux, H., N. Heise, T. Klenner, D. Hart, and F. R. Opperdoes. 2000. Ether-lipid (alkyl-phospholipid) metabolism and the mechanism of action of ether-lipid analogues in Leishmania. Mol Biochem Parasitol 111:1-14.

202. Lye, L. F., M. L. Cunningham, and S. M. Beverley. 2002. Characterization of quinonoid-dihydropteridine reductase (QDPR) from the lower eukaryote Leishmania major. J Biol Chem 277:38245-53.

203. Lye, L. F., S. O. Kang, J. D. Nosanchuk, A. Casadevall, and S. M. Beverley. 2011. Phenylalanine hydroxylase (PAH) from the lower eukaryote Leishmania major. Mol Biochem Parasitol 175:58-67.

204. Ma, D., S. M. Beverley, and S. J. Turco. 1996. Leishmania donovani possess a NADPH-dependent alkylglycerol cleavage enzyme. Biochem Biophys Res Commun 227:885-9.

205. Maarouf, M., M. T. Adeline, M. Solignac, D. Vautrin, and M. Robert-Gero. 1998. Development and characterization of paromomycin-resistant Leishmania donovani promastigotes. Parasite 5:167-73.

206. Maarouf, M., Y. de Kouchkovsky, S. Brown, P. X. Petit, and M. Robert-Gero. 1997. In vivo interference of paromomycin with mitochondrial activity of Leishmania. Exp Cell Res 232:339-48.

207. Maarouf, M., F. Lawrence, S. Brown, and M. Robert-Gero. 1997. Biochemical alterations in paromomycin-treated Leishmania donovani promastigotes. Parasitol Res 83:198-202.

208. Maarouf, M., F. Lawrence, S. L. Croft, and M. Robert-Gero. 1995. Ribosomes of Leishmania are a target for the aminoglycosides. Parasitol Res 81:421-5.

209. Marobbio, C. M., G. Agrimi, F. M. Lasorsa, and F. Palmieri. 2003. Identification and functional reconstitution of yeast mitochondrial carrier for S-adenosylmethionine. EMBO J 22:5975-82.

210. Marquis, N., B. Gourbal, B. P. Rosen, R. Mukhopadhyay, and M. Ouellette. 2005. Modulation in aquaglyceroporin AQP1 gene transcript levels in drug-resistant Leishmania. Mol Microbiol 57:1690-9.

211. Massimine, K. M., L. T. Doan, C. A. Atreya, T. T. Stedman, K S. Anderson, K A. Joiner, and I. Coppens. 2005. Toxoplasma gondii is capable of exogenous folate transport. A likely expansion ofthe BTI family of transmembrane proteins. Mol Biochem Parasitol 144:44-54.

198

212. Masuda, S. 2003. Functional characteristics and pharmacokinetic significance of kidney-specific organic anion transporters, OAT-K1 and OAT-K2, in the urinary excretion of anionic drugs. Drug Metab Pharmacokinet 18:91-103.

213. Matherly, L. H., Z. Hou, and Y. Deng. 2007. Human reduced folate carrier: translation of basic biology to cancer etiology and therapy. Cancer Metastasis Rev 26:111-28.

214. Mato, J. M., F. J. Corrales, S. C. Lu, and M. A. Avila. 2002. S-Adenosylmethionine: a control switch that regulates liver function. Faseb J 16:15-26.

215. Mato, J. M., M. L. Martinez-Chan tar, and S. C. Lu. 2008. Methionine metabolism and liver disease. Annu Rev Nutr 28:273-93.

216. Mbongo, N., P. M. Loiseau, M. A. Billion, and M. Robert-Gero. 1998. Mechanism of amphotericin B resistance in Leishmania donovani promastigotes. Antimicrob Agents Chemother 42:352-7.

217. McCarthy, E. A., S. A. Titus, S. M. Taylor, C. Jackson-Cook, and R. G. Moran. 2004. A mutation inactivating the mitochondrial inner membrane folate transporter creates a glycine requirement for survival of Chinese hamster cells. J Biol Chem 279:33829-36.

218. McConville, M. J., D. P. De Souza, E. C. Saunders, James Pyke, T. Naderer, M. A. Ellis, F. M. Sernee, J. E. Ralton, and V. A. Likic. 2008. Analysis of the Leishmania Metabolome. in Leishmania: After The Genome. Caister Academic Press, 306 pages.

219. McGuire, J. J. 2003. Anticancer antifolates: current status and future directions. Curr Pharm Des 9:2593-613.

220. McGuire, J. J., C. A. Russell, and M. Balinska. 2000. Human cytosolic and mitochondrial folylpolyglutamate synthetase are electrophoretically distinct. Expression in antifolate-sensitive and -resistant human cell lines. J Biol Chem 275:13012-6.

221. McKean, P. G., P. W. Denny, E. Knuepfer, J. K. Keen, and D. F. Smith. 2001. Phenotypic changes associated with deletion and overexpression of a stage-regulated gene family in Leishmania. Cell Microbiol 3:511-23.

222. McMillan, J. M., U. K. Walle, and T. Walle. 2005. S-adenosyl-L-methionine: transcellular transport and uptake by Caco-2 cells and hépatocytes. J Pharm Pharmacol 57:599-605.

223. McNicoll, F., J. Drummelsmith, M. Muller, E. Madore, N. Boilard, M. Ouellette, and B. Papadopoulou. 2006. A combined proteomic and transcriptomic approach to the study of stage differentiation in Leishmania infantum. Proteomics 6:3567-81.

224. McNicoll, F., M. Muller, S. Cloutier, N. Boilard, A. Rochette, M. Dube, and B. Papadopoulou. 2005. Distinct 3'-untranslated region elements regulate stage-specific mRNA accumulation and translation in Leishmania. J Biol Chem 280:35238-46.

225. Meek, T. D., E. P. Garvey, and D. V. Santi. 1985. Purification and characterization of the bifunctional thymidylate synthetase-dihydrofolate reductase from methotrexate-resistant Leishmania tropica. Biochemistry 24:678-86.

226. Merali, S., and A. B. Clarkson, Jr. 2004. S-adenosylmethionine and Pneumocystis. FEMS Microbiol Lett 237:179-86.

199

227. Mogi, M., K Kinpara, A. Kondo, and A. Togari. 1999. Involvement of nitric oxide and biopterin in proinflammatory cytokine-induced apoptotic cell death in mouse osteoblastic cell line MC3T3-E1. Biochem Pharmacol 58:649-54.

228. Moinard, C , L. Cynober, and J. P. de Bandt. 2005. Polyamines: metabolism and implications in human diseases. Clin Nutr 24:184-97.

229. Moran, R. G. 1999. Roles of folylpoly-gamma-glutamate synthetase in therapeutics with tétrahydrofolate antimetabolites: an overview. Semin Oncol 26:24-32.

230. Moreira, W., E. Leblanc, and M. Ouellette. 2009. The role of reduced pterins in resistance to reactive oxygen and nitrogen intermediates in the protozoan parasite Leishmania. Free Radie Biol Med 46:367-75.

231. Mosesson, Y., and Y. Yarden. 2006. Monoubiquitylation: a recurrent theme in membrane protein transport. Isr Med Assoc J 8:233-7.

232. Mottino, A. D., T. Hoffman, L. Jennes, and M. Vore. 2000. Expression and localization of multidrug resistant protein mrp2 in rat small intestine. J Pharmacol Exp Ther 293:717-23.

233. Mukherjee, A., P. K Padmanabhan, M. H. Sahani, M. P. Barrett, and R. Madhubala. 2006. Roles for mitochondria in pentamidine susceptibility and resistance in Leishmania donovani. Mol Biochem Parasitol 145:1-10.

234. Mukherjee, A., G. Roy, C. Guimond, and M. Ouellette. 2009. The gamma-glutamylcysteine synthetase gene of Leishmania is essential and involved in response to oxidants. Mol Microbiol 74:914-27.

235. Muller, M., P. K Padmanabhan, and B. Papadopoulou. 2010a. Selective inactivation of SIDER2 retroposon-mediated mRNA decay contributes to stage- and species-specific gene expression in Leishmania. Mol Microbiol 77:471-91.

236. Muller, M., P. K. Padmanabhan, A. Rochette, D. Mukherjee, M. Smith, C. Dumas, and B. Papadopoulou. 2010b. Rapid decay of unstable Leishmania mRNAs bearing a conserved retroposon signature 3'-UTR motif is initiated by a site-specific endonucleolytic cleavage without prior deadenylation. Nucleic Acids Res 38:5867-83.

237. Muller, M., and B. Papadopoulou. 2010c. Stage-specific expression ofthe glycine cleavage complex subunits in Leishmania infantum. Mol Biochem Parasitol 170:17-27.

238. Muller, S., E. Liebau, R. D. Walter, and R. L. Krauth-Siegel. 2003. Thiol-based redox metabolism of protozoan parasites. Trends Parasitol 19:320-8.

239. Murphy, J. T., and K D. Spence. 1972. Transport of S-adenosylmethionine in Saccharomyces cerevisiae. J Bacteriol 109:499-504.

240. Murta, S. M., T. J. Vickers, D. A. Scott, and S. M. Beverley. 2009. Methylene tétrahydrofolate dehydrogenase/cyclohydrolase and the synthesis of 10-CHO-THF are essential in Leishmania major. Mol Microbiol 71:1386-401.

241. Myint, H. Y., P. Tipmanee, F. Nosten, N. P. Day, S. Pukrittayakamee, S. Looareesuwan, and N. J. White. 2004. A systematic overview of published antimalarial drug trials. Trans R Soc Trop Med Hyg 98:73-81.

242. Myler, P. J., E. Sisk, P. D. McDonagh, S. Martinez-Calvillo, A. Schnaufer, S. M. Sunkin, S. Yan, R. Madhubala, A. Ivens, and K. Stuart. 2000. Genomic organization and gene function in Leishmania. Biochem Soc Trans 28:527-31.

243. Nakai, Y., K Inoue, N. Abe, M. Hatakeyama, K Y. Ohta, M. Otagiri, Y. Hayashi, and H. Yuasa. 2007. Functional characterization of human proton-

200

coupled folate transporter/heme carrier protein 1 heterologously expressed in mammalian cells as a folate transporter. J Pharmacol Exp Ther 322:469-76.

244. Nare, B., L. A. Garraway, T. J. Vickers, and S. M. Beverley. 2009. PTR1-dependent synthesis of tetrahydrobiopterin contributes to oxidant susceptibility in the trypanosomatid protozoan parasite Leishmania major. Curr Genet 55:287-99.

245. Nare, B., L. W. Hardy, and S. M. Beverley. 1997b. The roles of ptéridine reductase 1 and dihydrofolate reductase-thymidylate synthase in ptéridine metabolism in the protozoan parasite Leishmania major. J Biol Chem 272:13883-91.

246. Nare, B., J. Luba, L. W. Hardy, and S. Beverley. 1997a. New approaches to Leishmania chemotherapy: ptéridine reductase 1 (PTRl) as a target and modulator of antifolate sensitivity. Parasitology 114 Suppl:S101-10.

247. Neal, R. A., M. V. Iwobi, and M. Robert-Gero. 1989. Antileishmanial effect of free and encapsulated sinefungin against Leishmania donovani infections in BALB/c mice. C R Acad Sci III 308:485-8.

248. Noiriel, A., V. Naponelli, J. F. Gregory, 3rd, and A. D. Hanson. 2007. Pterin and folate salvage. Plants and Escherichia coli lack capacity to reduce oxidized pterins. Plant Physiol 143:1101-9.

249. Nolan, L. L. 1987. Molecular target ofthe antileishmanial action of sinefungin. Antimicrob Agents Chemother 31:1542-8.

250. Nosei, C , and J. L. Avila. 1985. Serine hydroxymethyltransferase activity in Trypanosoma cruzi, Trypanosoma rangeli and American Leishmania spp. Comp Biochem Physiol B 81:701-4.

251. Nozaki, T., V. Ali, and M. Tokoro. 2005. Sulfur-containing amino acid metabolism in parasitic protozoa. Adv Parasitol 60:1-99.

252. Nozaki, T., Y. Shigeta, Y. Saito-Nakano, M. Imada, and W. D. Kruger. 2001. Characterization of transsulfuration and cysteine biosynthetic pathways in the protozoan hemoflagellate, Trypanosoma cruzi. Isolation and molecular characterization of cystathionine beta-synthase and serine acetyltransferase from Trypanosoma. J Biol Chem 276:6516-23.

253. Nozaki, Y., H. Kusuhara, H. Endou, and Y. Sugiyama. 2004. Quantitative evaluation of the drug-drug interactions between methotrexate and nonsteroidal anti-inflammatory drugs in the renal uptake process based on the contribution of organic anion transporters and reduced folate carrier. J Pharmacol Exp Ther 309:226-34.

254. Nzila, A. 2006. The past, present and future of antifolates in the treatment of Plasmodium falciparum infection. J Antimicrob Chemother 57:1043-54.

255. Obasaju, C. K , Z. Ye, A. J. Wozniak, C. P. Belani, M. L. Keohan, H. J. Ross, J. A. Polikoff, D. M. Mintzer, M. J. Monberg, and P. A. Janne. 2007. Single-arm, open label study of pemetrexed plus cisplatin in chemotherapy naive patients with malignant pleural mesothelioma: outcomes of an expanded access program. Lung Cancer 55:187-94.

256. Oe, H., M. Kohashi, and K Iwai. 1983. Radioassay of the folate-hydrolyzing enzyme activity, and the distribution of the enzyme in biological cells and tissues. J Nutr Sci Vitaminol (Tokyo) 29:523-31.

257. Ortiz, D., R. Valdes, M. A. Sanchez, J. Hayenga, C. Elya, S. Detke, and S. M. Landfear. 2010. Purine restriction induces pronounced translational upregulation of

201

the NT1 adenosine/pyrimidine nucleoside transporter in Leishmania major. Mol Microbiol 78:108-18.

258. Ouellette, M., and P. Borst. 1991. Drug resistance and P-glycoprotein gene amplification in the protozoan parasite Leishmania. Res Microbiol 142:737-46.

259. Ouellette, M., J. Drummelsmith, A. El-Fadili, C. Kundig, D. Richard, and G. Roy. 2002. Pterin transport and metabolism in Leishmania and related trypanosomatid parasites. Int J Parasitol 32:385-98.

260. Ouellette, M., J. Drummelsmith, and B. Papadopoulou. 2004. Leishmaniasis: drugs in the clinic, resistance and new developments. Drug Resist Updat 7:257-66.

261. Ouellette, M., A. Haimeur, K Grondin, D. Legare, and B. Papadopoulou. 1998b. Amplification of ABC transporter gene pgpA and of other heavy metal resistance genes in Leishmania tarentolae and their study by gene transfection and gene disruption. Methods Enzymol 292:182-93.

262. Ouellette, M., E. Leblanc, C. Kundig, and B. Papadopoulou. 1998a. Antifolate resistance mechanisms from bacteria to cancer cells with emphasis on parasites. Adv Exp Med Biol 456:99-113.

263. Ouellette, M., M. Olivier, S. Sato, and B. Papadopoulou. 2003. Le parasite Leishmania à l'ère de la post-génomique. M/S : médecine sciences 19:900-909.

264. Oza, S. L., M. P. Shaw, S. Wyllie, and A. H. Fairlamb. 2005. Trypanothione biosynthesis in Leishmania major. Mol Biochem Parasitol 139:107-16.

265. Palatnik-de-Sousa, C. B. 2008. Vaccines for leishmaniasis in the fore coming 25 years. Vaccine 26:1709-24.

266. Palmieri, F. 2004. The mitochondrial transporter family (SLC25): physiological and pathological implications. Pflugers Arch. 447:689-709.

267. Palmieri, L., R. Arrigoni, E. Blanco, F. Carrari, M. I. Zanor, C. Studart-Guimaraes, A. R. Feraie, and F. Palmieri. 2006. Molecular identification of an Arabidopsis S-adenosylmethionine transporter. Analysis of organ distribution, bacterial expression, reconstitution into liposomes, and functional characterization. Plant Physiol 142:855-65.

268. Palmieri, L., H. Rottensteiner, W. Girzalsky, P. Scarcia, F. Palmieri, and R. Erdmann. 2001. Identification and functional reconstitution of the yeast peroxisomal adenine nucleotide transporter. EMBO J 20:5049-59.

269. Paolantonacci, P., F. Lawrence, F. Lederer, and M. Robert-Gero. 1986. Protein methylation and protein methylases in Leishmania donovani and Leishmania tropica promastigotes. Mol Biochem Parasitol 21:47-54.

270. Paolantonacci, P., F. Lawrence, and M. Robert-Gero. 1985. Differential effect of sinefungin and its analogs on the multiplication of three Leishmania species. Antimicrob Agents Chemother 28:528-31.

271. Papadopoulou, B., and M. Ouellette. 1993. Frequent amplification of a short chain dehydrogenase gene in methotrexate resistant Leishmania. Adv Exp Med Biol 338:559-62.

272. Papadopoulou, B., G. Roy, M. Breton, C. Kundig, C. Dumas, I. Fillion, A. K. Singh, M. Olivier, and M. Ouellette. 2002. Reduced infectivity of a Leishmania donovani biopterin transporter genetic mutant and its use as an attenuated strain for vaccination. Infect Immun 70:62-8.

202

273. Papadopoulou, B., G. Roy, S. Dey, B. P. Rosen, and M. Ouellette. 1994b. Contribution of the Leishmania P-glycoprotein-related gene ltpgpA to oxyanion resistance. J Biol Chem 269:11980-6.

274. Papadopoulou, B., G. Roy, W. Mourad, E. Leblanc, and M. Ouellette. 1994a. Changes in folate and pterin metabolism after disruption of the Leishmania H locus short chain dehydrogenase gene. J Biol Chem 269:7310-5.

275. Papadopoulou, B., G. Roy, and M. Ouellette. 1993. Frequent amplification of a short chain dehydrogenase gene as part of circular and linear amplicons in methotrexate resistant Leishmania. Nucleic Acids Res 21:4305-12.

276. Papadopoulou, B., G. Roy, and M. Ouellette. 1992. A novel antifolate resistance gene on the amplified H circle of Leishmania. EMBO J 11:3601-8.

277. Parker, N., M. J. Turk, E. Westrick, J. D. Lewis, P. S. Low, and C. P. Leamon. 2005. Folate receptor expression in carcinomas and normal tissues determined by a quantitative radioligand binding assay. Anal Biochem 338:284-93.

278. Peacock, C. S., K Seeger, D. Harris, L. Murphy, J. C. Ruiz, M. A. Quail, N. Peters, E. Adlem, A. Tivey, M. Aslett, A. Kerhomou, A. Ivens, A. Fraser, M. A. Rajandream, T. Carver, H. Norbertczak, T. Chillingworth, Z. Hance, K Jagels, S. Moule, D. Ormond, S. Rutter, R. Squares, S. Whitehead, E. Rabbinowitsch, C. Arrowsmith, B. White, S. Thurston, F. Bringaud, S. L. Baldauf, A. Faulconbridge, D. J effares, D. P. Depledge, S. O. Oyola, J. D. Hilley, L. O. Brito, L. R. Tosi, B. BarreU, A. K Cruz, J. C. Mottram, D. F. Smith, and M. Berriman. 2007. Comparative genomic analysis of three Leishmania species that cause diverse human disease. Nat Genet 39:839-47.

279. Peixoto, M. P., and S. M. Beverley. 1987. In vitro activity of sulfonamides and sulfones against Leishmania major promastigotes. Antimicrob Agents Chemother 31:1575-8.

280. Perchiniak, E., S. A. Lawrence, S. Kasten, B. A. Woodard, S. M. Taylor, and R. G. Moran. 2007. Probing the mechanism of the hamster mitochondrial folate transporter by mutagenesis and homology modeling. Biochemistry 46:1557-67.

281. Perez-Pertejo, Y., R. M. Reguera, C. Garcia-Estrada, R. Balana-Fouce, and D. Ordonez. 2004. Mutational analysis of methionine adénosyltransférase from Leishmania donovani. Eur J Biochem 271:2791-8.

282. Perez-Pertejo, Y., R. M. Reguera, D. Ordonez, and R. Balana-Fouce. 2006. Characterization of a methionine adénosyltransférase over-expressing strain in the trypanosomatid Leishmania donovani. Biochim Biophys Acta 1760:10-9.

283. Perez-Pertejo, Y., R. M. Reguera, H. Villa, C. Garcia-Estrada, R. Balana-Fouce, M. A. Pajares, and D. Ordonez. 2003. Leishmania donovani methionine adénosyltransférase. Role of cysteine residues in the recombinant enzyme. Eur J Biochem 270:28-35.

284. Perez-Victoria, F. J., S. Castanys, and F. Gamarro. 2003. Leishmania donovani resistance to miltefosine involves a defective inward translocation of the drug. Antimicrob Agents Chemother 47:2397-403.

285. Perez-Victoria, F. J., F. Gamarro, M. Ouellette, and S. Castanys. 2003. Functional cloning of the miltefosine transporter. A novel P-type phospholipid translocase from Leishmania involved in drug resistance. J Biol Chem 278:49965-71.

203

286. Peters, N. C , J. G. Egen, N. Secundino, A. Debrabant, N. Kimblin, S. Kamhawi, P. Lawyer, M. P. Fay, R. N. Germain, and D. Sacks. 2008. In vivo imaging reveals an essential role for neutrophils in leishmaniasis transmitted by sand flies. Science 321:970-4.

287. Petrillo-Peixoto, M. L., and S. M. Beverley. 1988. Amplified DNAs in laboratory stocks of Leishmania tarentolae: extrachromosomal circles structurally and functionally similar to the inverted-H-region amplification of methotrexate-resistant Leishmania major. Mol Cell Biol 8:5188-99.

288. Petrotta-Simpson, T. F., J. E. Talmadge, and K D. Spence. 1975. Specificity and genetics of S-adenosylmethionine transport in Saccharomyces cerevisiae. J Bacteriol 123:516-22.

289. Pez, D., I. Leal, F. Zuccotto, C. Boussard, R. Brun, S. L. Croft, V. Yardley, L. M. Ruiz Perez, D. Gonzalez Pacanowska, and I. H. Gilbert. 2003. 2,4-Diaminopyrimidines as inhibitors of Leishmanial and Trypanosomal dihydrofolate reductase. Bioorg Med Chem 11:4693-711.

290. Phelouzat, M. A., M. Basselin, F. Lawrence, and M. Robert-Gero. 1995. Sinefungin shares AdoMet-uptake system to enter Leishmania donovani promastigotes. Biochem J 305 ( Pt 1): 133-7.

291. Picault, N., M. Hodges, L. Palmieri, and F. Palmieri. 2004. The growing family of mitochondrial carriers in Arabidopsis. Trends Plant Sci. 9:138-46.

292. Prabhu, V., K B. Chatson, H. Lui, G. D. Abrams, and J. King. 1998. Effects of sulfanilamide and methotrexate on 13C fluxes through the glycine decarboxylase/serine hydroxymethyltransferase enzyme system in arabidopsis. Plant Physiol 116:137-44.

293. Prakash, S., G. Cooper, S. Singhi, and M. H. Saier, Jr. 2003. The ion transporter superfamily. Biochim Biophys Acta 1618:79-92.

294. Prasad, P. D., V. B. Mahesh, F. H. Leibach, and V. Ganapathy. 1994. Functional coupling between a bafilomycin A1-sensitive proton pump and a probenecid-sensitive folate transporter in human placental choriocarcinoma cells. Biochim Biophys Acta 1222:309-14.

295. Prasad, P. D., S. Ram a moor thy, F. H. Leibach, and V. Ganapathy. 1995. Molecular cloning of the human placental folate transporter. Biochem Biophys Res Commun 206:681-7.

296. Pugh, C. S., R. T. Borchardt, and H. O. Stone. 1978. Sinefungin, a potent inhibitor of virion mRNA(guanine-7-)-methyltransferase, mRNA(nucleoside-2'-)-methyltransferase, and viral multiplication. J Biol Chem 253:4075-7.

297. Qiu, A., M. Jansen, A. Sakaris, S. H. Min, S. Chattopadhyay, E. Tsai, C. Sandoval, R. Zhao, M. H. Akabas, and I. D. Goldman. 2006. Identification of an intestinal folate transporter and the molecular basis for hereditary folate malabsorption. Cell 127:917-28.

298. Qiu, A., S. H. Min, M. Jansen, U. Malhotra, E. Tsai, D. C. Cabelof, L. H. Matherly, R. Zhao, M. H. Akabas, and I. D. Goldman. 2007. Rodent intestinal folate transporters (SLC46A1): secondary structure, functional properties, and response to dietary folate restriction. Am J Physiol Cell Physiol 293:C1669-78.

299. Quinlivan, E. P., J. McPartlin, D. G. Weir, and J. Scott. 2000. Mechanism ofthe antimicrobial drug trimethoprim revisited. FASEB J 14:2519-24.

204

300. Raichaudhuri, A., M. Peng, V. Naponelli, S. Chen, R. Sanchez-Fernandez, H. Gu, J. F. Gregory, 3rd, A. D. Hanson, and P. A. Rea. 2009. Plant Vacuolar ATP-binding Cassette Transporters That Translocate Folates and Antifolates in Vitro and Contribute to Antifolate Tolerance in Vivo. J Biol Chem 284:8449-60.

301. Rajgopal, A., A. Edmondnson, I. D. Goldman, and R. Zhao. 2001. SLC19A3 encodes a second thiamine transporter ThTr2. Biochim Biophys Acta 1537:175-8.

302. Rakotomanga, M., S. Blanc, K. Gaudin, P. Chaminade, and P. M. Loiseau. 2007. Miltefosine affects lipid metabolism in Leishmania donovani promastigotes. Antimicrob Agents Chemother 51:1425-30.

303. Ramaekers, V. T., N. Blau, J. M. Sequeira, M. C. Nassogne, and E. V. Quadros. 2007. Folate receptor autoimmunity and cerebral folate deficiency in low-functioning autism with neurological deficits. Neuropediatrics 38:276-81.

304. Ramaekers, V. T., S. P. Rothenberg, J. M. Sequeira, T. Opladen, N. Blau, E. V. Quadros, and J. Selhub. 2005. Autoantibodies to folate receptors in the cerebral folate deficiency syndrome. N Engl J Med 352:1985-91.

305. Ratnam, M., H. Marquardt, J. L. Duhring, and J. H. Freisheim. 1989. Homologous membrane folate binding proteins in human placenta: cloning and sequence of a cDNA. Biochemistry 28:8249-54.

306. Ravanel, S., M. A. Block, P. Rippert, S. Jabrin, G. Curien, F. Renville, and R. Douce. 2004. Methionine metabolism in plants: chloroplasts are autonomous for de novo methionine synthesis and can import S-adenosylmethionine from the cytosol. J Biol Chem 279:22548-57.

307. Rebeille, F., S. Ravanel, A. Marquet, R. R. Mendel, M. E. Webb, A. G. Smith, and M. J. Warren. 2007. Roles of vitamins B5, B8, B9, B12 and molybdenum cofactor at cellular and organismal levels. Nat Prod Rep 24:949-62.

308. Reddy, J. A., L. S. Haneline, E. F. Srour, A. C. Antony, D. W. Clapp, and P. S. Low. 1999. Expression and functional characterization ofthe beta-isoform ofthe folate receptor on CD34(+) cells. Blood 93:3940-8.

309. Reguera, R. M., R. Balana-Fouce, Y. Perez-Pertejo, F. J. Fernandez, C. Garcia-Estrada, J. C. Cubria, C. Ordonez, and D. Ordonez. 2002. Cloning expression and characterization of methionine adénosyltransférase in Leishmania infantum promastigotes. J Biol Chem 277:3158-67.

310. Reguera, R. M., C. M. Redondo, Y. Perez-Pertejo, and R. Balana-Fouce. 2007. S-Adenosylmethionine in protozoan parasites: functions, synthesis and regulation. Mol Biochem Parasitol 152:1-10.

311. Richard, D., C. Kundig, and M. Ouellette. 2002. A new type of high affinity folic acid transporter in the protozoan parasite Leishmania and deletion of its gene in methotrexate-resistant cells. J Biol Chem 277:29460-7.

312. Richard, D., P. Leprohon, J. Drummelsmith, and M. Ouellette. 2004. Growth phase regulation of the main folate transporter of Leishmania infantum and its role in methotrexate resistance. J Biol Chem 279:54494-501.

313. Rizwan, A. N., and G. Burckhardt. 2007. Organic anion transporters of the SLC22 family: biopharmaceutical, physiological, and pathological roles. Pharm Res 24:450-70.

314. Robello, C , P. Navarro, S. Castanys, and F. Gamarro. 1997. A ptéridine reductase gene ptrl contiguous to a P-glycoprotein confers resistance to antifolates in Trypanosoma cruzi. Mol Biochem Parasitol 90:525-35.

205

315. Roberts, S. C , J. Scott, J. E. Gasteier, Y. Jiang, B. Brooks, A. Jardim, N. S. Carter, O. Heby, and B. Ullman. 2002. S-adenosylmethionine decarboxylase from Leishmania donovani. Molecular, genetic, and biochemical characterization of null mutants and overproducers. J Biol Chem 277:5902-9.

316. Rodionov, D. A., P. Hebbeln, A. Eudes, J. ter Beek, I. A. Rodionova, G. B. Erkens, D. J. Slotboom, M. S. Gelfand, A. L. Osterman, A. D. Hanson, and T. Eitinger. 2009. A novel class of modular transporters for vitamins in prokaryotes. J Bacteriol 191:42-51.

317. Roje, S., H. Wang, S. D. McNeil, R. K. Raymond, D. R. Appling, Y. Shachar-Hill, H. J. Bohnert, and A. D. Hanson. 1999. Isolation, characterization, and functional expression of cDNAs encoding NADH-dependent methylenetetrahydrofolate reductase from higher plants. J Biol Chem 274:36089-96.

318. Ross, J. F., H. Wang, F. G. Behm, P. Mathew, M. Wu, R. Booth, and M. Ratnam. 1999. Folate receptor type beta is a neutrophilic lineage marker and is differentially expressed in myeloid leukemia. Cancer 85:348-57.

319. Rost, D., S. Mahner, Y. Sugiyama, and W. Stremmel. 2002. Expression and localization of the multidrug resistance-associated protein 3 in rat small and large intestine. Am J Physiol Gastrointest Liver Physiol 282:G720-6.

320. Rothberg, K C , Y. S. Yin», J. F. Kolhouse, B. A. Kamen, and R. G. Anderson. 1990. The glycophospholipid-linked folate receptor internalizes folate without entering the clathrin-coated pit endocytic pathway. J Cell Biol 110:637-49.

321. Rouillon, A., Y. Surdin-Kerjan, and D. Thomas. 1999. Transport of sulfonium compounds. Characterization of the s-adenosylmethionine and s-methylmethionine permeases from the yeast Saccharomyces cerevisiae. J Biol Chem 274:28096-105.

322. Roy, G., C. Kundig, M. Olivier, B. Papadopoulou, and M. Ouellette. 2001. Adaptation of Leishmania cells to in vitro culture results in a more efficient reduction and transport of biopterin. Exp Parasitol 97:161-8.

323. Rubin-Bejerano, I., I. Fraser, P. G ris a fi, and G. R. Fink. 2003. Phagocytosis by neutrophils induces an amino acid deprivation response in Saccharomyces cerevisiae and Candida albicans. Proc Natl Acad Sci U S A 100:11007-12.

324. Sacks, D., and S. Kamhawi. 2001. Molecular aspects of parasite-vector and vector-host interactions in leishmaniasis. Annu Rev Microbiol 55:453-83.

325. Sacks, D. L. 1989. Metacyclogenesis in Leishmania promastigotes. Exp Parasitol 69:100-3.

326. Sadasivan, E., and S. P. Rothenberg. 1989. The complete amino acid sequence of a human folate binding protein from KB cells determined from the cDNA. J Biol Chem 264:5806-11.

327. Said, H. M., N. Chatterjee, R. U. Haq, V. S. Subramanian, A. Ortiz, L. H. Matherly, F. M. Sirotnak, C. Halsted, and S. A. Rubin. 2000. Adaptive regulation of intestinal folate uptake: effect of dietary folate deficiency. Am J Physiol Cell Physiol 279:C1889-95.

328. Saier, M. H., Jr. 2000. A functional-phylogenetic classification system for transmembrane solute transporters. Microbiol Mol Biol Rev 64:354-411.

329. Salazar, M. D., and M. Ratnam. 2007. The folate receptor: what does it promise in tissue-targeted therapeutics? Cancer Metastasis Rev 26:141-52.

206

330. Salger, K , and B. W. Wetterauer. 2000. Aberrant folate response and premature development in a mutant of Dictyostelium discoideum. Differentiation 66:197-207.

331. Saliba, K J., S. Krishna, and K Kirk. 2004. Inhibition of hexose transport and abrogation of pH homeostasis in the intraerythrocytic malaria parasite by an 0-3-hexose derivative. FEBS Lett 570:93-6.

332. Salotra, P., and R. Singh. 2006. Challenges in the diagnosis of post kala-azar dermal leishmaniasis. Indian J Med Res 123:295-310.

333. Salter, A. J. 1982. Trimethoprim-sulfamethoxazole in treatment of severe infections. Rev Infect Dis 4:338-50.

334. Santi, D. V., P. Nolan, and B. Shane. 1987. Folylpolyglutamates in Leishmania major. Biochem Biophys Res Commun 146:1089-92.

335. S au rat, J. H., G. Stingl, L. Dubertret, K Papp, R. G. Langley, J. P. Ortonne, K Unnebrink, M. Kaul, and A. Camez. 2008. Efficacy and safety results from the randomized controlled comparative study of adalimumab vs. methotrexate vs. placebo in patients with psoriasis (CHAMPION). Br J Dermatol 158:558-66.

336. Scheffer, G. L., M. Kool, M. de Haas, J. M. de Vree, A. C. Pijnenborg, D. K. Bosnian. R. P. Elferink, P. van der Valk, P. Borst, and R. J. Scheper. 2002. Tissue distribution and induction of human multidrug resistant protein 3. Lab Invest 82:193-201.

337. Schirch, V., and W. B. Strong. 1989. Interaction of folylpolyglutamates with enzymes in one-carbon metabolism. Arch Biochem Biophys 269:371-80.

338. Schluckebier, G., M. Kozak, N. Bleimling, E. Weinhold, and W. Saenger. 1997. Differential binding of S-adenosylmethionine S-adenosylhomocysteine and Sinefungin to the adenine-specific DNA méthyltransférase M.Taql. J Mol Biol 265:56-67.

339. Schormann, N., B. Pal, O. Senkovich, M. Carson, A. Howard, C. Smith, L. Delucas, and D. Chattopadhyay. 2005. Crystal structure of Trypanosoma cruzi ptéridine reductase 2 in complex with a substrate and an inhibitor. J Struct Biol 152:64-75.

340. Schubert, H. L., R. M. Blumen thai, and X. Cheng. 2003. Many paths to methyltransfer: a chronicle of convergence. Trends Biochem Sci 28:329-35.

341. Schweitzer, B. I., A. P. Dicker, and J. R. Bertino. 1990. Dihydrofolate reductase as a therapeutic target. FASEB J 4:2441-52.

342. Schwencke, J., and H. De Robichon-Szulmajster. 1976. The transport of S-adenosyl-L-methionine in isolated yeast vacuoles and spheroplasts. Eur J Biochem 65:49-60.

343. Scott, D. A., G. H. Coombs, and B. E. Sanderson. 1987. Folate utilisation by Leishmania species and the identification of intracellular derivatives and folate-metabolising enzymes. Mol Biochem Parasitol 23:139-49.

344. Scott, D. A., S. M. Hickerson, T. J. Vickers, and S. M. Beverley. 2008. The role of the mitochondrial glycine cleavage complex in the metabolism and virulence of the protozoan parasite Leishmania major. J Biol Chem. 283:155-65.

345. Segovia, M., and G. Ortiz. 1997. LD1 amplifications in Leishmania. Parasitol Today 13:342-8.

346. Seifert, K , S. Matu, F. Javier Perez-Victoria, S. Castanys, F. Gamarro, and S. L. Croft. 2003. Characterisation of Leishmania donovani promastigotes resistant to hexadecylphosphocholine (miltefosine). Int J Antimicrob Agents 22:380-7.

207

347. Sekine, T., H. Miyazaki, and H. Endou. 2006. Molecular physiology of renal organic anion transporters. Am J Physiol Renal Physiol 290:F251-61.

348. Sereno, D., M. Cavaleyra, K Zemzoumi, S. Maquaire, A. Ouaissi, and J. L. Lemesre. 1998. Axenically grown amastigotes of Leishmania infantum used as an in vitro model to investigate the pentavalent antimony mode of action. Antimicrob Agents Chemother 42:3097-102.

349. Seshadri, S., A. Beiser, J. Selhub, P. F. Jacques, I. H. Rosenberg, R. B. D'Agostino, P. W. Wilson, and P. A. Wolf. 2002. Plasma homocysteine as a risk factor for dementia and Alzheimer's disease. N Engl J Med 346:476-83.

350. Shane, B. 1989. Folylpolyglutamate synthesis and role in the regulation of one-carbon metabolism. Vitam Horm 45:263-335.

351. Shanks, E. J., H. B. Ong, D. A. Robinson, S. Thompson, N. Sienkiewicz, A. H. Fairlamb, and J. A. Frearson. 2010. Development and validation of a cytochrome c-coupled assay for ptéridine reductase 1 and dihydrofolate reductase. Anal Biochem 396:194-203.

352. Shayeghi, M., G. O. Latunde-Dada, J. S. Oakhill, A. H. Laftah, K Takeuchi, N. Halliday, Y. Khan, A. Warley, F. E. McCann, R. C. Hider, D. M. Frazer, G. J. Anderson, C. D. Vulpe, R. J. Simpson, and A. T. McKie. 2005. Identification of an intestinal heme transporter. Cell 122:789-801.

353. Shen, F., M. Wu, J. F. Ross, D. Miller, and M. Ratnam. 1995. Folate receptor type gamma is primarily a secretory protein due to lack of an efficient signal for glycosylphosphatidylinositol modification: protein characterization and cell type specificity. Biochemistry 34:5660-5.

354. Sienkiewicz, N., H. B. Ong, and A. H. Fairlamb. 2010. Trypanosoma brucei ptéridine reductase 1 is essential for survival in vitro and for virulence in mice. Mol Microbiol 77:658-71.

355. Smith, G. K , W. T. Mueller, P. A. Benkovic, and S. J. Benkovic. 1981. On the cofactor specificity of glycinamide ribonucleotide and 5-aminoimidazole-4-carboxamide ribonucleotide transformylase from chicken liver. Biochemistry 20:1241-5.

356. S pinks, I)., H. B. Ong, C. P. Mpamhanga, E. J. Shanks, D. A. Robinson, I. T. Collie, K D. Read, J. A. Frearson, P. G. Wyatt, R. Brink, A. H. Fairlamb, and I. H. Gilbert. 2011. Design, synthesis and biological evaluation of novel inhibitors of Trypanosoma brucei ptéridine reductase 1. ChemMedChem 6:302-8.

357. Staub, O., and D. Rotin. 2006. Role of ubiquitylation in cellular membrane transport. Physiol Rev 86:669-707.

358. Stokstad, E. L., and T. H. Jukes. 1987. Sulfonamides and folic acid antagonists: a historical review. J Nutr 117:1335-41.

359. Stover, P. J. 2004. Physiology of folate and vitamin B12 in health and disease. Nutr Rev 62:S3-12; discussion S13.

360. Stramentinoli, G. 1987. Pharmacologic aspects of S-adenosylmethionine. Pharmacokinetics and pharmacodynamics. Am J Med 83:35-42.

361. Stramentinoli, G., M. Gualano, and M. Galli-Kienle. 1979. Intestinal absorption of S-adenosyl-L-methionine. J Pharmacol Exp Ther 209:323-6.

362. Subramanian, V. S., N. Chatterjee, and H. M. Said. 2003. Folate uptake in the human intestine: promoter activity and effect of folate deficiency. J Cell Physiol 196:403-8.

208

363. Sundar, S. 2001. Drug resistance in Indian visceral leishmaniasis. Trop Med Int Health 6:849-54.

364. Sundar, S., T. K. Jha, C. P. Thakur, S. K Bhattacharya, and M. Rai. 2006. Oral miltefosine for the treatment of Indian visceral leishmaniasis. Trans R Soc Trop Med Hyg 100 Suppl l:S26-33.

365. Sundar, S., T. K. Jha, C. P. Thakur, M. Mishra, V. P. Singh, and R. Buffels. 2003. Single-dose liposomal amphotericin B in the treatment of visceral leishmaniasis in India: a multicenter study. Clin Infect Dis 37:800-4.

366. Sundar, S., K Kumar, J. Chakravarty, D. Agrawal, S. Agrawal, A. Chhabra, and V. Singh. 2006. Cure of antimony-unresponsive Indian post-kala-azar dermal leishmaniasis with oral miltefosine. Trans R Soc Trop Med Hyg 100:698-700.

367. Sweiry, J. H., and D. L. Yudilevich. 1988. Characterization of folate uptake in guinea pig placenta. Am J Physiol 254:C735-43.

368. Sweiry, J. H., and D. L. Yudilevich. 1985. Transport of folates at maternal and fetal sides of the placenta: lack of inhibition by methotrexate. Biochim Biophys Acta 821:497-501.

369. Takeda, M., S. Khamdang, S. Narikawa, H. Kimura, M. Hosoyamada, S. H. Cha, T. Sekine, and H. Endou. 2002. Characterization of methotrexate transport and its drug interactions with human organic anion transporters. J Pharmacol Exp Ther 302:666-71.

370. Takemura, Y., H. Kobayashi, and H. Miyachi. 2001. Antifolate resistance and its circumvention by new analogues. Hum Cell 14:185-202.

371. Takeuchi, N., M. Kawakami, A. Omori, T. Ueda, L. L. Spremulli, and K Watanabe. 1998. Mammalian mitochondrial methionyl-tRNA transformylase from bovine liver. Purification, characterization, and gene structure. J Biol Chem 273:15085-90.

372. Tan, T. H., N. Bochud-Allemann, E. K. Horn, and A. Schneider. 2002. Eukaryotic-type elongator tRNAMet of Trypanosoma brucei becomes formylated after import into mitochondria. Proc Natl Acad Sci U S A 99:1152-7.

373. Thony, B., G. Auerbach, and N. Blau. 2000. Tetrahydrobiopterin biosynthesis, regeneration and functions. Biochem J 347 Pt 1:1-16.

374. Tibbetts, A. S., and D. R. Appling. 2010. Compartmentalization of Mammalian folate-mediated one-carbon metabolism. Annu Rev Nutr 30:57-81.

375. Titus, R. G., F. J. Gueiros-Filho, L. A. de Freitas, and S. M. Beverley. 1995. Development of a safe live Leishmania vaccine line by gene replacement. Proc Natl Acad Sci U S A 92:10267-71.

376. Titus, S. A., and R. G. Moran. 2000. Retrovirally mediated complementation of the glyB phénotype. Cloning of a human gene encoding the carrier for entry of folates into mitochondria. J Biol Chem 275:36811-7.

377. Trager, W. 1969. Ptéridine requirement of the hemoflagellate Leishmania tarentolae. J Protozool 16:372-5.

378. Trager, W., M. Tershakovec, P. K Chiang, and G. L. Cantoni. 1980. Plasmodium falciparum: antimalarial activity in culture of sinefungin and other methylation inhibitors. Exp Parasitol 50:83-9.

379. Tripp, C. A., P. J. Myler, and K Stuart. 1991. A DNA sequence (LD1) which occurs in several genomic organizations in Leishmania. Mol Biochem Parasitol 47:151-6.

209

380. Trippett, T. M., S. Garcia, K. Manova, R. Mody, L. Cohen-Gould, W. Flintoff, and J. R. Bertino. 2001. Localization of a human reduced folate carrier protein in the mitochondrial as well as the cell membrane of leukemia cells. Cancer Res 61:1941-7.

381. Tucker, A. M., H. H. Winkler, L. O. Driskell, and D. O. Wood. 2003. S-adenosylmethionine transport in Rickettsia prowazekii. J Bacteriol 185:3031-5.

382. Tulloch, L. B., V. P. Martini, J. Iulek, J. K. Huggan, J. H. Lee, C. L. Gibson, T. K Smith, C. J. Suckling, and W. N. Hunter. 2010. Structure-based design of ptéridine reductase inhibitors targeting African sleeping sickness and the leishmaniases. J Med Chem 53:221-9.

383. Turner, M. A., X. Yang, D. Yin, K Kuczera, R. T. Borchardt, and P. L. Howell. 2000. Structure and function of S-adenosylhomocysteine hydrolase. Cell Biochem Biophys 33:101-25.

384. Ubeda, J. M., D. Legare, F. Raymond, A. A. Ouameur, S. Boisvert, P. RigauIt, J. Corbeil, M. J. Tremblay, M. Olivier, B. Papadopoulou, and M. Ouellette. 2008. Modulation of gene expression in drug resistant Leishmania is associated with gene amplification, gene deletion and chromosome aneuploidy. Genome Biol 9:R115.

385. Uemura, T., K Kashiwagi, and K. Igarashi. 2007. Polyamine uptake by DUR3 and SAM3 in Saccharomyces cerevisiae. J Biol Chem 282:7733-41.

386. Umapathy, N. S., J. P. Gnana-Prakasam, P. M. Martin, B. Mysona, Y. Dun, S. B. Smith, V. Ganapathy, and P. D. Prasad. 2007. Cloning and functional characterization ofthe proton-coupled electrogenic folate transporter and analysis of its expression in retinal cell types. Invest Ophthalmol Vis Sci 48:5299-305.

387. Unal, E. S., R. Zhao, A. Qiu, and I. D. Goldman. 2008. N-linked glycosylation and its impact on the electrophoretic mobility and function of the human proton-coupled folate transporter (HsPCFT). Biochim Biophys Acta 1778:1407-14.

388. Uwai, Y., R. Taniguchi, H. Motohashi, H. Saito, M. Okuda, and K. Inui. 2004. Methotrexate-loxoprofen interaction: involvement of human organic anion transporters hOATl and hOAT3. Drug Metab Pharmacokinet 19:369-74.

389. Vance, J. E., and D. E. Vance. 2004. Phospholipid biosynthesis in mammalian cells. Biochem Cell Biol 82:113-28.

390. Van Wert, A. L., and D. H. Sweet. 2008. Impaired clearance of methotrexate in organic anion transporter 3 (Slc22a8) knockout mice: a gender specific impact of reduced folates. Pharm Res 25:453-62.

391. Vatsyayan, R., and U. Roy. 2007. Molecular cloning and biochemical characterization of Leishmania donovani serine hydroxymethyltransferase. Protein Expr Purif 52:433-40.

392. Vercesi, A. E., and R. Docampo. 1992. Ca2+ transport by digitonin-permeabilized Leishmania donovani. Effects of Ca2+, pentamidine and WR-6026 on mitochondrial membrane potential in situ. Biochem J 284 ( Pt 2):463-7.

393. Vickers, T. J., S. M. Murta, M. A. Mandell, and S. M. Beverley. 2009. The enzymes of the 10-formyl-tetrahydrofolate synthetic pathway are found exclusively in the cytosol of the trypanosomatid parasite Leishmania major. Mol Biochem Parasitol 166:142-52.

394. Vickers, T. J., G. Orsomando, R. D. de la Garza, D. A. Scott, S. O. Kang, A. D. Hanson, and S. M. Beverley. 2006. Biochemical and genetic analysis of

210

methylenetetrahydrofolate reductase in Leishmania metabolism and virulence. J Biol Chem 281:38150-8.

395. Wagner, C. 1995. Biochemical role of folate in cellular metabolism. In "Folate in Health and Disease" (L. B. Bailey, ed.), pp. 23-42. New York, Marcel Dekker, Inc.

396. Walker, J., and J. Barrett. 1997. Parasite sulphur amino acid metabolism. Int J Parasitol 27:883-97.

397. Wang, H., X. Zheng, F. G. Behm, and M. Ratnam. 2000. Differentiation-independent retinoid induction of folate receptor type beta, a potential tumor target in myeloid leukemia. Blood 96:3529-36.

398. Wang, J., E. Leblanc, C. F. Chang, B. Papadopoulou, T. Bray, J. M. Whiteley, S. X. Lin, and M. Ouellette. 1997. Pterin and folate reduction by the Leishmania tarentolae H locus short-chain dehydrogenase/reductase PTRl. Arch Biochem Biophys 342:197-202.

399. Wang, P., Q. Wang, P. F. Sims, and J. E. Hyde. 2007. Characterisation of exogenous folate transport in Plasmodium falciparum. Mol Biochem Parasitol 154:40-51.

400. Washtien, W. L., R. Grumont, and D. V. Santi. 1985. DNA amplification in antifolate-resistant Leishmania. The thymidylate synthase-dihydrofolate reductase gene and abundant mRNAs. J Biol Chem 260:7809-12.

401. Wei, Y., and E. B. Newman. 2002. Studies on the role ofthe metK gene product of Escherichia coli K-12. Mol Microbiol 43:1651-6.

402. Whetstine, J. R , R. M. Flatley, and L. H. Matherly. 2002. The human reduced folate carrier gene is ubiquitously and differentially expressed in normal human tissues: identification of seven non-coding exons and characterization of a novel promoter. Biochem J 367:629-40.

403. Wielinga, P., J. H. Hooijberg, S. Gunnarsdottir, I. Kathmann, G. Reid, N. Zelcer, K. van der Born, M. de Haas, I. van der Heijden, G. Kaspers, J. Wijnholds, G. Jansen, G. Peters, and P. Borst. 2005. The human multidrug resistance protein MRP5 transports folates and can mediate cellular resistance against antifolates. Cancer Res 65:4425-30.

404. Williams, F. M., and W. F. Flintoff. 1995. Isolation of a human cDNA that complements a mutant hamster cell defective in methotrexate uptake. J Biol Chem 270:2987-92.

405. Williams, F. M., R. C. Murray, T. M. Underhill, and W. F. Flintoff. 1994. Isolation of a hamster cDNA clone coding for a function involved in methotrexate uptake. J Biol Chem 269:5810-6.

406. Williams, R. A., G. D. Westrop, and G. H. Coombs. 2009. Two pathways for cysteine biosynthesis in Leishmania major. Biochem J 420:451-62.

407. Wilson, K S., and S. C. Malfair Taylor. 2009. Raltitrexed: optimism and reality. Expert Opin Drug Metab Toxicol 5:1447-54.

408. Witt, T. L., S. E. Stapels, and L. H. Matherly. 2004. Restoration of transport activity by co-expression of human reduced folate carrier half-molecules in transport-impaired K562 cells: localization of a substrate binding domain to transmembrane domains 7-12. J Biol Chem 279:46755-63.

409. Wong, S. C , S. A. Proefke, A. Bhushan, and L. H. Matherly. 1995. Isolation of human cDNAs that restore methotrexate sensitivity and reduced folate carrier

211

activity in methotrexate transport-defective Chinese hamster ovary cells. J Biol Chem 270:17468-75.

410. Wong, S. C , L. Zhang, S. A. Proefke, and L. H. Matherly. 1998. Effects ofthe loss of capacity for N-glycosylation on the transport activity and cellular localization ofthe human reduced folate carrier. Biochim Biophys Acta 1375:6-12.

411. Wu, D., and W. M. Pardridge. 1999. Blood-brain barrier transport of reduced folic acid. Pharm Res 16:415-9.

412. Wyllie, S., M. L. Cunningham, and A. H. Fairlamb. 2004. Dual action of antimonial drugs on thiol redox metabolism in the human pathogen Leishmania donovani. J Biol Chem 279:39925-32.

413. Yarlett, N., and C. J. Bacchi. 1988. Effect of DL-alpha-difluoromethylornithine on methionine cycle intermediates in Trypanosoma brucei brucei. Mol Biochem Parasitol 27:1-10.

414. Zeng, H., Z. S. Chen, M. G. Belinsky, P. A. Rea, and G. D. Kruh. 2001. Transport of methotrexate (MTX) and folates by multidrug resistance protein (MRP) 3 and MRP1: effect of polyglutamylation on MTX transport. Cancer Res 61:7225-32.

415. Zhang, P., J. Wang, and Y. Shi. 2010. Structure and mechanism of the S component of abacterial ECF transporter. Nature 468:717-20.

416. Zhao, R., F. Gao, and I. D. Goldman. 2002. Reduced folate carrier transports thiamine monophosphate: an alternative route for thiamine delivery into mammalian cells. Am J Physiol Cell Physiol 282:C1512-7.

417. Zhao, R., F. Gao, Y. Wang, G. A. Diaz, B. D. Gelb, and I. D. Goldman. 2001. Impact of the reduced folate carrier on the accumulation of active thiamin metabolites in murine leukemia cells. J Biol Chem 276:1114-8.

418. Zhao, R., and I. D. Goldman. 2003. Resistance to antifolates. Oncogene 22:7431-57.

419. Zhao, R., L. H. Matherly, and I. D. Goldman. 2009. Membrane transporters and folate homeostasis: intestinal absorption and transport into systemic compartments and tissues. Expert Rev Mol Med ll:e4.

420. Zhao, R., A. Qiu, E. Tsai, M. Jansen, M. H. Akabas, and I. D. Goldman. 2008. The proton-coupled folate transporter: impact on pemetrexed transport and on antifolates activities compared with the reduced folate carrier. Mol Pharmacol 74:854-62.

421. Zheng, S., S. Shuman, and B. Schwer. 2007. Sinefungin resistance of Saccharomyces cerevisiae arising from Sam3 mutations that inactivate the AdoMet transporter or from increased expression of AdoMet synthase plus mRNA cap guanine-N7 méthyltransférase. Nucleic Acids Res 35:6895-903.

422. Zilberstein, D., and M. Shapira. 1994. The role of pH and temperature in the development of Leishmania parasites. Annu Rev Microbiol 48:449-70.